CoraLite® Plus 647 Anti-Human CD40 Rabbit scFv Antibody

• Home
• Products
• Primary Antibodies
• CoraLite® Plus 647 Anti-Human CD40 Rabbit scFv Antibody (CL647-SF98191)

• Site-specific conjugation

CD40 Recombinant Antibody for FC

Cat No. CL647-SF98191

Clone No.241760A9

Host / Type

Rabbit / scFv

Reactivity

human

Applications

FC

Synonyms

Bp50, CD40L receptor, p50, TNFRSF5

• 

  FC experiment of human PBMCs using CL647-SF98191

  1x10^6 human PBMCs were surface stained with CoraLite® Plus 405 Anti-Human CD19 (4G7), and 0.25 ug CoraLite® Plus 647 Anti-Human CD40 Rabbit scFv Antibody (CL647-SF98191, Clone: 241760A9) or unstained. Cells were not fixed. Lymphocytes were gated.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of human PBMCs using CL647-SF98191

  1x10^6 human PBMCs were surface stained with 0.25 ug CoraLite® Plus 647 Anti-Human CD40 Rabbit scFv Antibody (CL647-SF98191, Clone: 241760A9) (red), or unstained (blue). Cells were not fixed. Lymphocytes were gated.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive FC detected in: human PBMCs

Recommended dilution

• Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL647-SF98191 targets CD40 in FC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Type: Rabbit / scFv
• Class: Recombinant
• Type: Single-chain variable fragment antibody (scFv)
• Immunogen:

  CatNo: Eg1797

  Product name: Recombinant Human CD40/TNFRSF5 protein (rFc Tag)(HPLC verified)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 21-193 aa of NM_001250.6

  Sequence: EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLR

• Full Name: CD40 molecule, TNF receptor superfamily member 5
• Calculated Molecular Weight: 31kDa
• GenBank Accession Number: NM_001250.6
• Gene Symbol: CD40
• Gene ID (NCBI): 958
• ENSEMBL Gene ID: ENSG00000101017
• RRID: AB_3748943
• Conjugate: CoraLite® Plus 647 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 654 nm / 674 nm
• Excitation Laser: Red Laser (633 nm)
• Source: Anti-Human CD40 scFv from clone 241760A9, consisting of VH-GGGGS linker-VL (N- to C-terminus), with a His tag at the C-terminus.
• Form: Liquid
• Purification Method: Affinity purification
• Storage Buffer: 50mM HEPES, 150mM NaCl, 5mM EDTA, 0.1% CHAPS, 10% Sucrose and 0.1% Proclin300, pH 7.3.
• Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment. 20ul sizes contain 0.1% BSA.

Background Information

CD40, also named as TNFRSF5 and Bp50, is a receptor for TNFSF5/CD40LG. It is a member of the TNFR superfamily and is responsible for the efficient activation of cell-mediated and humoral immune responses via activated T cells and B cells, respectively. Defects in CD40 lead to hyper-IgM immunodeficiency syndrome type 3 (HIGM3) (PMID: 11675497). This is an autosomal recessive disorder that includes the inability of B cells to undergo isotype switching, a key step in the final differentiation of the humoral immune response, and an inability to mount an antibody-specific immune response.