Use Able AI chat for product recommendations
  • Zero Fc receptor binding
  • Site-specific conjugation
  • One universal isotype

FcZero-rAb® PE-Cyanine5.5 Anti-Mouse CD40L/CD154 Rabbit Recombinant Antibody

CD40L/CD154 FcZero-rAb® Recombinant Antibody for FC

Cat No. PY5P5-FcA98120
Clone No.240743E6

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC

CD154, Cd40l, CD40 ligand, Cd40lg, Tnfsf5

Formulation:  PBS, Azide
PBS, Azide
Conjugate:  PE-Cyanine5.5
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC detected inPMA and ionomycin treated mouse CD3+ T cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC)FC : 0.25 ug per 10^6 cells in a 100 µl suspension
This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

PY5P5-FcA98120 targets CD40L/CD154 in FC applications and shows reactivity with mouse samples.

Tested Reactivity mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg0990

Product name: Recombinant Mouse CD40L/CD154 protein (His Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: N-His

Domain: 115-260 aa of NM_011616.2

Sequence: GDEDPQIAAHVVSEANSNAASVLQWAKKGYYTMKSNLVMLENGKQLTVKREGLYYVYTQVTFCSNREPSSQRPFIVGLWLKPSSGSERILLKAANTHSSSQLCEQQSVHLGGVFELQAGASVFVNVTEASQVIHRVGFSSFGLLKL

Predict reactive species
Full Name CD40 ligand
Calculated Molecular Weight29 kDa
GenBank Accession NumberNM_011616.2
Gene Symbol CD154
Gene ID (NCBI) 21947
RRIDAB_3749977
Conjugate PE-Cyanine5.5 Fluorescent Dye
Excitation/Emission Maxima Wavelengths496 nm, 565 nm / 692 nm
Excitation LaserBlue Laser (488 nm), Green Laser (532 nm), Yellow-Green Laser (561 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP27548
Storage Buffer PBS with 0.09% sodium azide, pH 7.3.
Storage ConditionsStore at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

The CD40 ligand (CD40L, TRAP, CD154), a member of the TNF superfamily of ligands, is expressed as either a 33-kd transmembrane homologue or 18-kd soluble form (sCD154). CD40L is primarily expressed on activated CD4+ T cells and on a small proportion of CD8+ T cells and platelets. It binds to CD40 on antigen-presenting cells (APC), which leads to many effects depending on the target cell type. It has been suggested that CD40/CD40L interactions regulate oxidative stress and affect various signaling pathways in both the immunological and the cardiovascular systems. The CD40/CD40L system is also involved in tumorigenesis. Its expression is tightly regulated, and abnormal levels of CD40L are associated with the pathogenesis of atheromatous plaque destabilization and thrombotic events. Multiple mutations in CD40LG gene have been identified that are associated with hyper-IgM immunodeficiency syndrome type 1.

Protocols

Product Specific Protocols
FC protocol for PE-Cyanine5.5 CD40L/CD154 antibody PY5P5-FcA98120Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...