Tested Applications
| Positive WB detected in | human peripheral blood platelets |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 1 publications below |
Product Information
32462-1-AP targets CD42c in WB, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag36521 Product name: Recombinant human GP1BB protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 27-147 aa of NM_000407.4 Sequence: PAPCSCAGTLVDCGRRGLTWASLPTAFPVDTTELVLTGNNLTALPPGLLDALPALRTAHLGANPWRCDCRLVPLRAWLAGRPERAPYRDLRCVAPPALRGRLLPYLAEDELRAACAPGPLC Predict reactive species |
| Full Name | glycoprotein Ib (platelet), beta polypeptide |
| Calculated Molecular Weight | 22kDa,206aa |
| Observed Molecular Weight | 26 kDa |
| GenBank Accession Number | NM_000407.4 |
| Gene Symbol | CD42c |
| Gene ID (NCBI) | 2812 |
| RRID | AB_3742616 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | P13224 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CD42c, also known as platelet glycoprotein Ib beta chain (GP1BB), is a transmembrane protein containing a leucine-rich amino acid sequence (PMID: 3353370). CD42c is covalently linked to platelet glycoprotein Ib alpha chain (CD42b/GP1BA) to form GPIb, which is part of the Glycoprotein Ib-V-IX receptor (GPIb-V-IX) complex that constitutes the receptor for von Willebrand factor (VWF), and mediates platelet adhesion (PMID: 7660135). Mutations in the GP1BB gene have been associated with Bernard-Soulier syndrome, velocardiofacial syndrome, and giant platelet disorder.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for CD42c antibody 32462-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

