Use Able AI chat for product recommendations

Mouse CD44 Recombinant monoclonal antibody, PBS Only (Capture)

CD44 Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, IF-P, IF-Fro, Sandwich ELISA, Indirect ELISA

Cat No. 85163-5-PBS
Clone No.242666C11

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, IF-P, IF-Fro, Sandwich ELISA, Indirect ELISA

242666C11, CD44 antigen, CDw44, CSPG8, ECMR III

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85163-5-PBS targets CD44 as part of a matched antibody pair:

MP01873-5: 85163-5-PBS capture and 85163-9-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg3159

Product name: Recombinant Mouse CD44 protein (rFc Tag) (HPLC verified)

Source: mammalian cells-derived, V37

Tag: C-rFc

Domain: 25-224 aa of NM_009851.2

Sequence: QIDLNVTCRYAGVFHVEKNGRYSISRTEAADLCQAFNSTLPTMDQMKLALSKGFETCRYGFIEGNVVIPRIHPNAICAANHTGVYILVTSNTSHYDTYCFNASAPPEEDCTSVTDLPNSFDGPVTITIVNRDGTRYSKKGEYRTHQEDIDASNIIDDDVSSGSTIEKSTPESYILHTYLPTEQPTGDQDDSFFIRSTLAT

Predict reactive species
Full Name CD44 antigen
Calculated Molecular Weight86 kDa
Observed Molecular Weight85 kDa
GenBank Accession NumberNM_009851.2
Gene Symbol Cd44
Gene ID (NCBI) 12505
RRIDAB_3744070
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDNP_033981
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

CD44 is a type I transmembrane glycoprotein expressed on embryonic stem cells and in various levels on other cell types including connective tissues and bone marrow. CD44 expression is also upregulated in subpopulations of cancer cells and is recognized as a molecular marker for cancer stem cells (PMID: 29747682). It is a cell-surface receptor that mediates cell-cell and cell-matrix interactions through its affinity for hyaluronic acid (HA) and possibly also through its affinity for other ligands (PMID: 10694938). Adhesion with HA plays an important role in cell migration, tumor growth and progression. CD44 is also involved in lymphocyte activation, recirculation and homing, and in hematopoiesis.

Loading...
||
New chat

Able

正在加载,请稍候...