CoraLite® Plus 488 Anti-Human CD45 Rabbit scFv Antibody

• Home
• Products
• Primary Antibodies
• CoraLite® Plus 488 Anti-Human CD45 Rabbit scFv Antibody (CL488-SF98117)

• Site-specific conjugation

CD45 Recombinant Antibody for FC

Cat No. CL488-SF98117

Clone No.241670E10

Host / Type

Rabbit / scFv

Reactivity

human

Applications

FC

Synonyms

EC:3.1.3.48, GP180, L CA, LCA, L-CA

• 

  FC experiment of human PBMCs using CL488-SF98117

  1x10^6 human PBMCs were surface stained with 0.25 ug CoraLite® Plus 488 Anti-Human CD45 Rabbit scFv Antibody (CL488-SF98117, Clone: 241670E10) or 0.25 ug CoraLite® Plus 488 Rabbit scFv Isotype Control (CL488-SF98136, Clone: 240953C9). Cells were not fixed.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of human PBMCs using CL488-SF98117

  1x10^6 human PBMCs were surface stained with 0.25 ug CoraLite® Plus 488 Anti-Human CD45 Rabbit scFv Antibody (CL488-SF98117, Clone: 241670E10) (red) or 0.25 ug CoraLite® Plus 488 Rabbit scFv Isotype Control (CL488-SF98136, Clone: 240953C9) (blue). Cells were not fixed.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive FC detected in: human PBMCs

Recommended dilution

• Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-SF98117 targets CD45 in FC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Type: Rabbit / scFv
• Class: Recombinant
• Type: Single-chain variable fragment antibody (scFv)
• Immunogen:

  CatNo: Eg2486

  Product name: recombinant human CD45(220-577) protein

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 220-577 aa of NM_002838.4

  Sequence: ATTPSKPTCDEKYANITVDYLYNKETKLFTAKLNVNENVECGNNTCTNNEVHNLTECKNASVSISHNSCTAPDKTLILDVPPGVEKFQLHDCTQVEKADTTICLKWKNIETFTCDTQNITYRFQCGNMIFDNKEIKLENLEPEHEYKCDSEILYNNHKFTNASKIIKTDFGSPGEPQIIFCRSEAAHQGVITWNPPQRSFHNFTLCYIKETEKDCLNLDKNLIKYDLQNLKPYTKYVLSLHAYIIAKVQRNGSAAMCHFTTKSAPPSQVWNMTVSMTSDNSMHVKCRPPRDRNGPHERYHLEVEAGNTLVRNESHKNCDFRVKDLQYSTDYTFKAYFHNGDYPGEPFILHHSTSYNSK

• Full Name: protein tyrosine phosphatase, receptor type, C
• Calculated Molecular Weight: 147 kDa
• GenBank Accession Number: NM_002838.4
• Gene Symbol: CD45
• Gene ID (NCBI): 5788
• ENSEMBL Gene ID: ENSG00000081237
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Excitation Laser: Blue laser (488 nm)
• Source: Anti-Human CD45 scFv from clone 241670E10, consisting of VH-GGGGS linker-VL (N- to C-terminus), with a His tag at the C-terminus.
• Form: Liquid
• Purification Method: Affinity purification
• Storage Buffer: 50mM HEPES, 150mM NaCl, 5mM EDTA, 0.1% CHAPS, 10% Sucrose and 0.1% Proclin300, pH 7.3.
• Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment. 20ul sizes contain 0.1% BSA.

Background Information

CD45, also known as protein tyrosine phosphatase, receptor type C, is a type I transmembrane protein expressed on the surface of all haematopoietic cells with the exception of erythrocytes and platelets (PMID: 3489673; 28615666). CD45 is a pan-haematopoietic cell marker and has been shown to be essential for T- and B-cell activation and signalling (PMID: 9429890; 16378097).