CD47 Polyclonal antibody, PBS Only

• 

  IHC staining of human prostate cancer using 20305-1-AP (same clone as 20305-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 20305-1-AP (CD47 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20305-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 20305-1-AP (same clone as 20305-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 20305-1-AP (CD47 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20305-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary tumor using 20305-1-AP (same clone as 20305-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 20305-1-AP (CD47 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20305-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary tumor using 20305-1-AP (same clone as 20305-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 20305-1-AP (CD47 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20305-1-PBS in a different storage buffer formulation.

CD47 Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 20305-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, Indirect ELISA

Synonyms

---

Product Information

20305-1-PBS targets CD47 in IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14132

  Product name: Recombinant human CD47 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-150 aa of BC010016

  Sequence: MWPLVAALLLGSACCGSAQLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSPNENILIVIFPI

• Full Name: CD47 molecule
• Calculated Molecular Weight: 323 aa, 35 kDa
• GenBank Accession Number: BC010016
• Gene Symbol: CD47
• Gene ID (NCBI): 961
• RRID: AB_10732838
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q08722
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CD47, also known as integrin-associated protein (IAP), is a member of the immunoglobulin superfamily containing a five-pass transmembrane attachment. CD47 is heavily glycosylated and widely expressed by hematopoietic and nonhematopoietic cells. CD47 interacts with several membrane integrins and also acts as a receptor for thrombospondin (THBS1). It is involved in a range of cellular processes, including apoptosis, proliferation, adhesion, and migration. CD47 also functions as a ligand for signal regulatory protein-α (SIRPα). Upon binding CD47, SIRPα initiates a signaling cascade that results in the inhibition of phagocytosis.