CoraLite® Plus 488-conjugated CD47 Recombinant monoclonal antibody

• 

  IF Staining of RAW 264.7 using CL488-85958

  Immunofluorescent analysis of (4% PFA) fixed RAW 264.7 cells using CoraLite® Plus 488 CD47 antibody (CL488-85958, Clone: 242850C4) at dilution of 1:200.

CD47 Uni-rAb^® Recombinant Antibody for IF/ICC

Cat No. CL488-85958

Clone No.242850C4

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

IF/ICC

Synonyms

IAP, Integrin-associated protein, Leukocyte surface antigen CD47

---

Tested Applications

• Positive IF/ICC detected in: RAW 264.7 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-85958 targets CD47 in IF/ICC applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1394

  Product name: Recombinant Mouse CD47 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 19-140 aa of NP_001355344.1

  Sequence: QLLFSNVNSIEFTSCNETVVIPCIVRNVEAQSTEEMFVKWKLNKSYIFIYDGNKNSTTTDQNFTSAKISVSDLINGIASLKMDKRDAMVGNYTCEVTELSREGKTVIELKNRTVSWFSPNEK

• Full Name: CD47 antigen (Rh-related antigen, integrin-associated signal transducer)
• Calculated Molecular Weight: 33 kDa
• Observed Molecular Weight: 45-55 kDa
• GenBank Accession Number: NP_001355344.1
• Gene Symbol: Cd47
• Gene ID (NCBI): 16423
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q61735-1
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

CD47, also known as integrin-associated protein (IAP), is a member of the immunoglobulin superfamily containing a five-pass transmembrane attachment. CD47 is heavily glycosylated and widely expressed by hematopoietic and nonhematopoietic cells. CD47 interacts with several membrane integrins and also acts as a receptor for thrombospondin (THBS1). It is involved in a range of cellular processes, including apoptosis, proliferation, adhesion, and migration. CD47 also functions as a ligand for signal regulatory protein-α (SIRPα). Upon binding CD47, SIRPα initiates a signaling cascade that results in the inhibition of phagocytosis.