Use Able AI chat for product recommendations

Anti-Mouse CD47 Rabbit scFv Antibody

CD47 Recombinant Antibody for FC

Cat No. SF98456-3-RR
Clone No.242850C4

Host / Type

Rabbit / scFv

Reactivity

mouse

Applications

FC

IAP, Integrin-associated protein, Leukocyte surface antigen CD47

Formulation:  HEPES, EDTA, CHAPS, Sucrose, Proclin300
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC detected inmouse splenocytes

Recommended dilution

ApplicationDilution
Flow Cytometry (FC)FC : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

SF98456-3-RR targets CD47 in FC applications and shows reactivity with mouse samples.

Tested Reactivity mouse
Host / Type Rabbit / scFv
Class Recombinant
Type Single-chain variable fragment antibody (scFv)
Immunogen

CatNo: Eg1394

Product name: Recombinant Mouse CD47 protein (rFc Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-rFc

Tag: C-rFc

Domain: 19-140 aa of NP_001355344.1

Sequence: QLLFSNVNSIEFTSCNETVVIPCIVRNVEAQSTEEMFVKWKLNKSYIFIYDGNKNSTTTDQNFTSAKISVSDLINGIASLKMDKRDAMVGNYTCEVTELSREGKTVIELKNRTVSWFSPNEK

Predict reactive species
Full Name CD47 antigen (Rh-related antigen, integrin-associated signal transducer)
Calculated Molecular Weight33 kDa
GenBank Accession NumberNP_001355344.1
Gene Symbol Cd47
Gene ID (NCBI) 16423
RRIDAB_3750162
Conjugate Unconjugated
SourceAnti-Mouse CD47 scFv from clone 242850C4, consisting of VH-GGGGS linker-VL (N- to C-terminus), with a His-C tag at the C-terminus.
FormLiquid
Purification MethodAffinity purification
Storage Buffer 50mM HEPES, 150mM NaCl, 5mM EDTA, 0.1% CHAPS, 10% Sucrose and 0.1% Proclin 300, pH 7.3.
Storage ConditionsStore at 2-8°C. Stable for one year after shipment. 20ul sizes contain 0.1% BSA.

Background Information

CD47, also known as integrin-associated protein (IAP), is a member of the immunoglobulin superfamily containing a five-pass transmembrane attachment. CD47 is heavily glycosylated and widely expressed by hematopoietic and nonhematopoietic cells. CD47 interacts with several membrane integrins and also acts as a receptor for thrombospondin (THBS1). It is involved in a range of cellular processes, including apoptosis, proliferation, adhesion, and migration. CD47 also functions as a ligand for signal regulatory protein-α (SIRPα). Upon binding CD47, SIRPα initiates a signaling cascade that results in the inhibition of phagocytosis.

Protocols

Product Specific Protocols
FC protocol for CD47 antibody SF98456-3-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...