CoraLite® Plus 647 Anti-Human CD48 Rabbit Recombinant Antibody

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• CoraLite® Plus 647 Anti-Human CD48 Rabbit Recombinant Antibody (CL647-98170)

CD48 Uni-rAb^® Recombinant Antibody for FC

Cat No. CL647-98170 Copied!

Clone No. 241389F8

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC

Synonyms

241389F8, BLAST, BLAST1, B-lymphocyte activation marker BLAST-1, CD48 antigen

• 

  FC experiment of human PBMCs using CL647-98170

  1x10^6 human PBMCs were surface stained with 5 ul CoraLite® Plus 647 Anti-Human CD48 Rabbit RecAb (CL647-98170, Clone: 241389F8) or CoraLite® Plus 647 Rabbit IgG Isotype Control Recombinant Antibody (CL647-98136, Clone: 240953C9). Cells were incubated with FC Receptor Block prior to staining. Cells were not fixed.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of human PBMCs using CL647-98170

  1x10^6 human PBMCs were surface stained with 5 ul CoraLite® Plus 647 Anti-Human CD48 Rabbit RecAb (CL647-98170, Clone: 241389F8) (red) or CoraLite® Plus 647 Rabbit IgG Isotype Control Recombinant Antibody (CL647-98136, Clone: 240953C9) (blue). Cells were incubated with FC Receptor Block prior to staining. Cells were not fixed.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CD48 in ?

Chat with Able

---

Tested Applications

• Positive FC detected in: human PBMCs

Recommended dilution

• Flow Cytometry (FC): FC : 5 ul per 10^6 cells in a 100 µl suspension

This reagent has been pre-titrated and tested for flow cytometric analysis. The suggested use of this reagent is 5 ul per 10^6 cells in a 100 µl suspension or 5 ul per 100 µl of whole blood.

Sample-dependent, Check data in validation data gallery.

Product Information

CL647-98170 targets CD48 in FC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1005

  Product name: Recombinant Human CD48 protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 27-220 aa of BC016182

  Sequence: QGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESVNYTWYGDKRPFPKELQNSVLETTLMPHNYSRCYTCQVSNSVSSKNGTVCLSPPCTLARS

• Full Name: CD48 molecule
• Calculated Molecular Weight: 43 kDa
• GenBank Accession Number: BC016182
• Gene Symbol: CD48
• Gene ID (NCBI): 962
• Conjugate: CoraLite® Plus 647 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 654 nm / 674 nm
• Excitation Laser: Red Laser (633 nm)
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P09326
• Storage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
• Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

Signaling lymphocytic activation molecule family 2 (SLAMF2, CD48) is an adhesion and costimulatory molecule expressed constitutively on most hematopoietic cells, particularly in antigen-presenting cells (APC). CD48 is expressed on all the hematopoietic cells, both in humans and mice, except for murine neutrophils and long-term HSC. CD48 exists as both a membrane-bound (mCD48) and a soluble (sCD48) form. CD48 can activate T cells, antigen-presenting cells and granulocytes, by binding to CD2 or bacterial FimH, and through cell intrinsic effects. Interactions between CD48 and its high-affinity ligand CD244 are more complex, with both stimulatory and inhibitory outcomes. CD48 expression is increased in autoimmunity and allergy diseases, and anti-CD48 monoclonal antibodies have been shown to attenuate experimental autoimmune encephalomyelitis.