CD5 Monoclonal antibody

• 

  IHC staining of human tonsillitis using 67278-1-Ig

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 67278-1-Ig (CD5 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 67278-1-Ig

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 67278-1-Ig (CD5 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 67278-1-Ig

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 67278-1-Ig (CD5 antibody) at dilution of 1:2000 (under 4x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of human tonsillitis using 67278-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed human tonsillitis tissue using CD5 antibody (67278-1-Ig, Clone: 4D12C10 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

• 

  IF Staining of human tonsillitis using 67278-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed human tonsillitis tissue using CD5 antibody (67278-1-Ig, Clone: 4D12C10 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

CD5 Monoclonal Antibody for IHC, IF-P, ELISA

Cat No. 67278-1-Ig

Clone No.4D12C10

Host / Isotype

Mouse / IgG2b

Reactivity

human

Applications

IHC, IF-P, ELISA

Synonyms

4D12C10, CD5 molecule, LEU1, Lymphocyte antigen T1/Leu 1, Lymphocyte antigen T1/Leu-1

---

Tested Applications

• Positive IHC detected in: human tonsillitis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: human tonsillitis tissue

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:1000-1:4000
• Immunofluorescence (IF)-P: IF-P : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

67278-1-Ig targets CD5 in IHC, IF-P, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11065

  Product name: Recombinant human CD5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 30-378 aa of BC027901

  Sequence: DPDFQARLTRSNSKCQGQLEVYLKDGWHMVCSQSWGRSSKQWEDPSQASKVCQRLNCGVPLSLGPFLVTYTPQSSIICYGQLGSFSNCSHSRNDMCHSLGLTCLEPQKTTPPTTRPPPTTTPEPTAPPRLQLVAQSGGQHCAGVVEFYSGSLGGTISYEAQDKTQDLENFLCNNLQCGSFLKHLPETEAGRAQDPGEPREHQPLPIQWKIQNSSCTSLEHCFRKIKPQKSGRVLALLCSGFQPKVQSRLVGGSSICEGTVEVRQGAQWAALCDSSSARSSLRWEEVCREQQCGSVNSYRVLDAGDPTSRGLFCPHQKLSQCHELWERNSYCKKVFVTCQDPNPAGLAAG

• Full Name: CD5 molecule
• Calculated Molecular Weight: 495 aa, 55 kDa
• GenBank Accession Number: BC027901
• Gene Symbol: CD5
• Gene ID (NCBI): 921
• ENSEMBL Gene ID: ENSG00000110448
• RRID: AB_2882546
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P06127
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD5 is a type I transmembrane glycoprotein of the scavenger receptor cysteine-rich family (PMID: 12403363). CD5 is expressed on a majority of thymocytes, mature T cells, B cell subsets, and peripheral blood dendritic cells (PMID: 9858516; 6156984; 10379049; 1384337). CD5 may act as a receptor in regulating T-cell proliferation. It functions as a negative regulator of TCR signaling during thymocyte development (PMID: 7542801).