CoraLite® Plus 488-conjugated CD5 Monoclonal antibody

• 

  IF Staining of human tonsillitis using CL488-67278

  Immunofluorescent analysis of (4% PFA) fixed human tonsillitis tissue using CoraLite® Plus 488 CD5 antibody (CL488-67278, Clone: 4D12C10 ) at dilution of 1:200.

• 

  IF Staining of human tonsillitis using CL488-67278

  Immunofluorescent analysis of (4% PFA) fixed human tonsillitis tissue using CoraLite® Plus 488 CD5 antibody (CL488-67278, Clone: 4D12C10 ) at dilution of 1:200.

CD5 Monoclonal Antibody for IF-P

Cat No. CL488-67278

Clone No.4D12C10

Host / Isotype

Mouse / IgG2b

Reactivity

Human

Applications

IF-P

Synonyms

CD5, CD5 molecule, LEU1, Lymphocyte antigen T1/Leu 1, T1

---

Tested Applications

• Positive IF-P detected in: human tonsillitis tissue

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67278 targets CD5 in IF-P applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11065

  Product name: Recombinant human CD5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 30-378 aa of BC027901

  Sequence: DPDFQARLTRSNSKCQGQLEVYLKDGWHMVCSQSWGRSSKQWEDPSQASKVCQRLNCGVPLSLGPFLVTYTPQSSIICYGQLGSFSNCSHSRNDMCHSLGLTCLEPQKTTPPTTRPPPTTTPEPTAPPRLQLVAQSGGQHCAGVVEFYSGSLGGTISYEAQDKTQDLENFLCNNLQCGSFLKHLPETEAGRAQDPGEPREHQPLPIQWKIQNSSCTSLEHCFRKIKPQKSGRVLALLCSGFQPKVQSRLVGGSSICEGTVEVRQGAQWAALCDSSSARSSLRWEEVCREQQCGSVNSYRVLDAGDPTSRGLFCPHQKLSQCHELWERNSYCKKVFVTCQDPNPAGLAAG

• Full Name: CD5 molecule
• Calculated Molecular Weight: 495 aa, 55 kDa
• GenBank Accession Number: BC027901
• Gene Symbol: CD5
• Gene ID (NCBI): 921
• ENSEMBL Gene ID: ENSG00000110448
• RRID: AB_2919443
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P06127
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

CD5 is a type I transmembrane glycoprotein of the scavenger receptor cysteine-rich family (PMID: 12403363). CD5 is expressed on a majority of thymocytes, mature T cells, B cell subsets, and peripheral blood dendritic cells (PMID: 9858516; 6156984; 10379049; 1384337). CD5 may act as a receptor in regulating T-cell proliferation. It functions as a negative regulator of TCR signaling during thymocyte development (PMID: 7542801).