CD5 Recombinant monoclonal antibody

• 

  WB analysis of Jurkat using 83543-7-RR

  Jurkat cells were subjected to SDS PAGE followed by western blot with 83543-7-RR (CD5 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human tonsil using 83543-7-RR

  Immunohistochemical analysis of paraffin-embedded human tonsil tissue slide using 83543-7-RR (CD5 antibody) at dilution of 1:3000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsil using 83543-7-RR

  Immunohistochemical analysis of paraffin-embedded human tonsil tissue slide using 83543-7-RR (CD5 antibody) at dilution of 1:3000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human ovary cancer using 83543-7-RR

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 83543-7-RR (CD5 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human ovary cancer using 83543-7-RR

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 83543-7-RR (CD5 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of Jurkat using 83543-7-RR

  Immunofluorescent analysis of (4% PFA) fixed Jurkat cells using CD5 antibody (83543-7-RR, Clone: 240428G2 ) at dilution of 1:250 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• 

  Affinity and Kinetic Characterization of 83543-7-RR

  Biolayer interferometry (BLl) kinetic assays of 83543-7-RR against Human CD5 were performed. The affinity constant is 2.09 nM.

CD5 Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 83543-7-RR

Clone No.240428G2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

240428G2, CD5 molecule, LEU1, Lymphocyte antigen T1/Leu 1, Lymphocyte antigen T1/Leu-1

---

Tested Applications

• Positive WB detected in: Jurkat cells
• Positive IHC detected in: human tonsil tissue, human ovary cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: Jurkat cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:1500-1:6000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

83543-7-RR targets CD5 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1119

  Product name: Recombinant Human CD5 protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 25-372 aa of NM_014207.4

  Sequence: RLSWYDPDFQARLTRSNSKCQGQLEVYLKDGWHMVCSQSWGRSSKQWEDPSQASKVCQRLNCGVPLSLGPFLVTYTPQSSIICYGQLGSFSNCSHSRNDMCHSLGLTCLEPQKTTPPTTRPPPTTTPEPTAPPRLQLVAQSGGQHCAGVVEFYSGSLGGTISYEAQDKTQDLENFLCNNLQCGSFLKHLPETEAGRAQDPGEPREHQPLPIQWKIQNSSCTSLEHCFRKIKPQKSGRVLALLCSGFQPKVQSRLVGGSSICEGTVEVRQGAQWAALCDSSSARSSLRWEEVCREQQCGSVNSYRVLDAGDPTSRGLFCPHQKLSQCHELWERNSYCKKVFVTCQDPNP

• Full Name: CD5 molecule
• Calculated Molecular Weight: 55 kDa
• Observed Molecular Weight: 60 kDa
• GenBank Accession Number: NM_014207.4
• Gene Symbol: CD5
• Gene ID (NCBI): 921
• ENSEMBL Gene ID: ENSG00000110448
• RRID: AB_3671163
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P06127
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD5 is a type I transmembrane glycoprotein of the scavenger receptor cysteine-rich family (PMID: 12403363). CD5 is expressed on a majority of thymocytes, mature T cells, B cell subsets, and peripheral blood dendritic cells (PMID: 9858516; 6156984; 10379049; 1384337). CD5 may act as a receptor in regulating T-cell proliferation. It functions as a negative regulator of TCR signaling during thymocyte development (PMID: 7542801).