CoraLite® Plus 750-conjugated CD5 Recombinant monoclonal antibody

• 

  WB analysis using CL750-83543-7

  Various lysates were subjected to SDS PAGE followed by western blot with CL750-83543-7 (CD5 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

CD5 Uni-rAb^® Recombinant Antibody for WB, FC, ELISA

Cat No. CL750-83543-7

Clone No.240428G2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, FC, ELISA

Synonyms

240428G2, CD5 molecule, LEU1, Lymphocyte antigen T1/Leu 1, Lymphocyte antigen T1/Leu-1

---

Tested Applications

• Positive WB detected in: Jurkat cells, MOLT-4 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL750-83543-7 targets CD5 in WB, FC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1119

  Product name: Recombinant Human CD5 protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 25-372 aa of NM_014207.4

  Sequence: RLSWYDPDFQARLTRSNSKCQGQLEVYLKDGWHMVCSQSWGRSSKQWEDPSQASKVCQRLNCGVPLSLGPFLVTYTPQSSIICYGQLGSFSNCSHSRNDMCHSLGLTCLEPQKTTPPTTRPPPTTTPEPTAPPRLQLVAQSGGQHCAGVVEFYSGSLGGTISYEAQDKTQDLENFLCNNLQCGSFLKHLPETEAGRAQDPGEPREHQPLPIQWKIQNSSCTSLEHCFRKIKPQKSGRVLALLCSGFQPKVQSRLVGGSSICEGTVEVRQGAQWAALCDSSSARSSLRWEEVCREQQCGSVNSYRVLDAGDPTSRGLFCPHQKLSQCHELWERNSYCKKVFVTCQDPNP

• Full Name: CD5 molecule
• Calculated Molecular Weight: 55 kDa
• Observed Molecular Weight: 60 kDa
• GenBank Accession Number: NM_014207.4
• Gene Symbol: CD5
• Gene ID (NCBI): 921
• ENSEMBL Gene ID: ENSG00000110448
• Conjugate: CoraLite® Plus 750 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 755 nm / 780 nm
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P06127
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

CD5 is a type I transmembrane glycoprotein of the scavenger receptor cysteine-rich family (PMID: 12403363). CD5 is expressed on a majority of thymocytes, mature T cells, B cell subsets, and peripheral blood dendritic cells (PMID: 9858516; 6156984; 10379049; 1384337). CD5 may act as a receptor in regulating T-cell proliferation. It functions as a negative regulator of TCR signaling during thymocyte development (PMID: 7542801).