FcZero-rAb® APC Anti-Human CD5 Rabbit Recombinant Antibody

• 

  FC experiment of human PBMCs using APC-FcA98054

  1x10^6 human PBMCs were surface stained with CoraLite® Plus 405 Anti-Human CD19 (4G7), and 5 ul APC Anti-Human CD5 Rabbit RecAb (APC-FcA98054, Clone: 240428A12) or Rabbit IgG Isotype Control RecAb (APC-FcA98136, Clone: 240953C9). Cells were not fixed.

• 

  FC experiment of human PBMCs using APC-FcA98054

  1x10^6 human PBMCs were surface stained with 5 ul APC Anti-Human CD5 Rabbit RecAb (APC-FcA98054, Clone: 240428A12) (red) or Rabbit IgG Isotype Control RecAb (APC-FcA98136, Clone: 240953C9) (blue). Cells were not fixed.

• Zero Fc receptor binding
• Site-specific conjugation
• One universal isotype

CD5 FcZero-rAb^® Recombinant Antibody for FC

Cat No. APC-FcA98054

Clone No.240428A12

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC

Synonyms

CD5 molecule, LEU1, Lymphocyte antigen T1/Leu 1, Lymphocyte antigen T1/Leu-1, T1

---

Tested Applications

• Positive FC detected in: human PBMCs

Recommended dilution

• Flow Cytometry (FC): FC : 5 ul per 10^6 cells in a 100 µl suspension

This reagent has been pre-titrated and tested for flow cytometric analysis. The suggested use of this reagent is 5 ul per 10^6 cells in a 100 µl suspension or 5 ul per 100 µl of whole blood.

Sample-dependent, Check data in validation data gallery.

Product Information

APC-FcA98054 targets CD5 in FC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1119

  Product name: Recombinant Human CD5 protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 25-372 aa of NM_014207.4

  Sequence: RLSWYDPDFQARLTRSNSKCQGQLEVYLKDGWHMVCSQSWGRSSKQWEDPSQASKVCQRLNCGVPLSLGPFLVTYTPQSSIICYGQLGSFSNCSHSRNDMCHSLGLTCLEPQKTTPPTTRPPPTTTPEPTAPPRLQLVAQSGGQHCAGVVEFYSGSLGGTISYEAQDKTQDLENFLCNNLQCGSFLKHLPETEAGRAQDPGEPREHQPLPIQWKIQNSSCTSLEHCFRKIKPQKSGRVLALLCSGFQPKVQSRLVGGSSICEGTVEVRQGAQWAALCDSSSARSSLRWEEVCREQQCGSVNSYRVLDAGDPTSRGLFCPHQKLSQCHELWERNSYCKKVFVTCQDPNP

• Full Name: CD5 molecule
• Calculated Molecular Weight: 55 kDa
• GenBank Accession Number: NM_014207.4
• Gene Symbol: CD5
• Gene ID (NCBI): 921
• ENSEMBL Gene ID: ENSG00000110448
• Conjugate: APC Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 650 nm / 660 nm
• Excitation Laser: Red Laser (633 nm)
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P06127
• Storage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
• Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

CD5 is a type I transmembrane glycoprotein of the scavenger receptor cysteine-rich family (PMID: 12403363). CD5 is expressed on a majority of thymocytes, mature T cells, B cell subsets, and peripheral blood dendritic cells (PMID: 9858516; 6156984; 10379049; 1384337). CD5 may act as a receptor in regulating T-cell proliferation. It functions as a negative regulator of TCR signaling during thymocyte development (PMID: 7542801).