Anti-Human CD5 Rabbit scFv Antibody

• Home
• Products
• Primary Antibodies
• Anti-Human CD5 Rabbit scFv Antibody (SF98054-1-RR)

CD5 Recombinant Antibody for FC

Cat No. SF98054-1-RR Copied!

Clone No. 240428A12

Download datasheet

Host / Type

Rabbit / scFv

Reactivity

human

Applications

FC

Synonyms

CD5 molecule, LEU1, Lymphocyte antigen T1/Leu 1, Lymphocyte antigen T1/Leu-1, T1

• 

  SDS-PAGE of SF98054-1-RR

  Purity of Recombinant ScFv antibody(Cat No.:SF98054-1-RR) was determined by SDS-PAGE. The protein was resolved in an SDS-PAGE in reducing (R) and condition and stained using Coomassie blue.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of human PBMCs using SF98054-1-RR

  1x10^6 human PBMCs were surface stained with 0.25 ug Anti-Human CD5 Rabbit scFv Antibody (SF98054-1-RR, Clone: 240428A12) or Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9), and PE Anti-GGGGS Linker Rabbit Recombinant Antibody. Cells were then stained with CoraLite® Plus 647 Anti-Human CD19. Cells were not fixed.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Affinity and Kinetic Characterization of SF98054-1-RR

  Biolayer interferometry (BLl) kinetic assays of SF98054-1-RR against Human CD5 were performed. The affinity constant is below 1 pM.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Affinity and Kinetic Characterization of SF98054-1-RR

  Biolayer interferometry (BLl) kinetic assays of SF98054-1-RR against Human CD4 were performed. The affinity constant is 0.416 nM.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CD5 in ?

Chat with Able

---

Tested Applications

• Positive FC detected in: human PBMCs

Recommended dilution

• Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

SF98054-1-RR targets CD5 in FC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Type: Rabbit / scFv
• Class: Recombinant
• Type: Single-chain variable fragment antibody (scFv)
• Immunogen:

  CatNo: Eg1119

  Product name: Recombinant Human CD5 protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 25-372 aa of NM_014207.4

  Sequence: RLSWYDPDFQARLTRSNSKCQGQLEVYLKDGWHMVCSQSWGRSSKQWEDPSQASKVCQRLNCGVPLSLGPFLVTYTPQSSIICYGQLGSFSNCSHSRNDMCHSLGLTCLEPQKTTPPTTRPPPTTTPEPTAPPRLQLVAQSGGQHCAGVVEFYSGSLGGTISYEAQDKTQDLENFLCNNLQCGSFLKHLPETEAGRAQDPGEPREHQPLPIQWKIQNSSCTSLEHCFRKIKPQKSGRVLALLCSGFQPKVQSRLVGGSSICEGTVEVRQGAQWAALCDSSSARSSLRWEEVCREQQCGSVNSYRVLDAGDPTSRGLFCPHQKLSQCHELWERNSYCKKVFVTCQDPNP

• Full Name: CD5 molecule
• Calculated Molecular Weight: 55 kDa
• GenBank Accession Number: NM_014207.4
• Gene Symbol: CD5
• Gene ID (NCBI): 921
• ENSEMBL Gene ID: ENSG00000110448
• RRID: AB_3750145
• Conjugate: Unconjugated
• Source: Anti-Human CD5 scFv from clone 240428A12, consisting of VH-GGGGS linker-VL (N- to C-terminus), with a His-C tag at the C-terminus.
• Form: Liquid
• Purification Method: Affinity purification
• Storage Buffer: 50mM HEPES, 150mM NaCl, 5mM EDTA, 0.1% CHAPS, 10% Sucrose and 0.1% Proclin300, pH 7.3.
• Storage Conditions: Store at 2-8°C. Stable for one year after shipment. 20ul sizes contain 0.1% BSA.

Background Information

CD5 is a type I transmembrane glycoprotein of the scavenger receptor cysteine-rich family (PMID: 12403363). CD5 is expressed on a majority of thymocytes, mature T cells, B cell subsets, and peripheral blood dendritic cells (PMID: 9858516; 6156984; 10379049; 1384337). CD5 may act as a receptor in regulating T-cell proliferation. It functions as a negative regulator of TCR signaling during thymocyte development (PMID: 7542801).