CD52 Polyclonal antibody

• 

  IHC staining of human tonsillitis using 21809-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 21809-1-AP (CD52 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 21809-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 21809-1-AP (CD52 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

CD52 Polyclonal Antibody for IHC, ELISA

Cat No. 21809-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF, IHC, ELISA

Synonyms

Cambridge pathology 1 antigen, CAMPATH 1 antigen, CD52, CD52 molecule, CDW52, He5

---

Tested Applications

• Positive IHC detected in: human tonsillitis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IHC: See 1 publications below
• IF: See 1 publications below

Product Information

21809-1-AP targets CD52 in IF, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17788

  Product name: Recombinant human CD52 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 20-61 aa of BC000644

  Sequence: QTGLSGQNDTSQTSSPSASSSMSGGIFLFFVANAIIHLFCFS

• Full Name: CD52 molecule
• Calculated Molecular Weight: 6 kDa
• GenBank Accession Number: BC000644
• Gene Symbol: CD52
• Gene ID (NCBI): 1043
• RRID: AB_2878920
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P31358
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Front Genet; Identification of susceptibility modules and hub genes of osteoarthritis by WGCNA analysis; Authors - Yanchao Wang
human	IF	Am J Physiol Cell Physiol; RNA-sequencing and immunofluorescence of the myotendinous junction of mature horses and humans.; Authors - Jens R Jakobsen