CD52 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CD52 Polyclonal antibody, PBS Only (21809-1-PBS)

CD52 Polyclonal Antibody for IHC, IF-P, ELISA

Cat No. 21809-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, IF-P, ELISA

Synonyms

Cambridge pathology 1 antigen, CAMPATH 1 antigen, CAMPATH-1 antigen, CD52 molecule, He5

• 

  IHC staining of human tonsillitis using 21809-1-AP (same clone as 21809-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 21809-1-AP (CD52 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21809-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 21809-1-AP (same clone as 21809-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 21809-1-AP (CD52 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21809-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of human tonsillitis using 21809-1-AP (same clone as 21809-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human tonsillitis tissue using CD52 antibody (21809-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21809-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of human tonsillitis using 21809-1-AP (same clone as 21809-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human tonsillitis tissue using CD52 antibody (21809-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21809-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

21809-1-PBS targets CD52 in IHC, IF-P, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17788

  Product name: Recombinant human CD52 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 20-61 aa of BC000644

  Sequence: QTGLSGQNDTSQTSSPSASSSMSGGIFLFFVANAIIHLFCFS

• Full Name: CD52 molecule
• Calculated Molecular Weight: 6 kDa
• GenBank Accession Number: BC000644
• Gene Symbol: CD52
• Gene ID (NCBI): 1043
• RRID: AB_2878920
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P31358
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.