CoraLite® Plus 488 Anti-Human CD55 Rabbit Recombinant Antibody

• 

  FC experiment of human peripheral blood leukocytes using CL488-98493-3

  1x10^6 human peripheral blood leukocytes were surface stained with 5 ul CoraLite® Plus 488 Anti-Human CD55 Rabbit RecAb (CL488-98493-3, Clone:250682C11), or CoraLite® Plus 488 Rabbit IgG Isotype Control RecAb (CL488-98136, Clone: 240953C9). Cells were incubated with FC Receptor Block prior to staining. Cells were not fixed.

• 

  FC experiment of human peripheral blood leukocytes using CL488-98493-3

  1x10^6 human peripheral blood leukocytes were surface stained with 5 ul CoraLite® Plus 488 Anti-Human CD55 Rabbit RecAb (CL488-98493-3, Clone:250682C11) (red), or CoraLite® Plus 488 Rabbit IgG Isotype Control RecAb (CL488-98136, Clone: 240953C9) (blue). Cells were incubated with FC Receptor Block prior to staining. Cells were not fixed.

CD55 Uni-rAb^® Recombinant Antibody for FC

Cat No. CL488-98493-3

Clone No.250682C11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC

Synonyms

Complement decay-accelerating factor, CR, CROM, DAF, TC

---

Tested Applications

• Positive FC detected in: FC receptor blocked human peripheral blood leukocytes

Recommended dilution

• Flow Cytometry (FC): FC : 5 ul per 10^6 cells in a 100 µl suspension

This reagent has been pre-titrated and tested for flow cytometric analysis. The suggested use of this reagent is 5 ul per 10^6 cells in a 100 µl suspension or 5 ul per 100 µl of whole blood.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-98493-3 targets CD55 in FC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg4246

  Product name: Recombinant Human CD55 protein (rFc Tag)(HPLC verified)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 35-353 aa of BC001288

  Sequence: DCGLPPDVPNAQPALEGRTSFPEDTVITYKCEESFVKIPGEKDSVICLKGSQWSDIEEFCNRSCEVPTRLNSASLKQPYITQNYFPVGTVVEYECRPGYRREPSLSPKLTCLQNLKWSTAVEFCKKKSCPNPGEIRNGQIDVPGGILFGATISFSCNTGYKLFGSTSSFCLISGSSVQWSDPLPECREIYCPAPPQIDNGIIQGERDHYGYRQSVTYACNKGFTMIGEHSIYCTVNNDEGEWSGPPPECRGKSLTSKVPPTVQKPTTVNVPTTEVSPTSQKTTTKTTTPNAQATRSTPVSRTTKHFHETTPNKGSGTTS

• Full Name: CD55 molecule, decay accelerating factor for complement (Cromer blood group)
• Calculated Molecular Weight: 41 kDa
• GenBank Accession Number: BC001288
• Gene Symbol: CD55
• Gene ID (NCBI): 1604
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Excitation Laser: Blue laser (488 nm)
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P08174
• Storage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
• Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

CD55, also known as DAF, is a glycosylphosphatidylinositol (GPI)-anchored surface glycoprotein that is widely distributed on blood, stroma, epithelial, and endothelial cells (PMID: 7517044; 29503741). It can also exist as a soluble form in plasma, urine, saliva, tears, and synovial fluids (PMID: 29503741). CD55 is a complement regulatory protein (PMID: 2469439; 7517044). It inhibits formation of the C3 convertases through binding to C3b and C4b. It also binds the alternate pathway convertase C3bBb, the classical pathway convertase and C4b2a to accelerate their decay (PMID: 17289551). CD55 also serves as a receptor for coxsackieviruses B1, B3, and B5 and several enteroviruses (PMID: 7538177; 7517044).