FcZero-rAb® PE Anti-Mouse CD55 Rabbit Recombinant Antibody

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• FcZero-rAb® PE Anti-Mouse CD55 Rabbit Recombinant Antibody (PE-FcA98228)

• Zero Fc receptor binding
• Site-specific conjugation
• One universal isotype

CD55 FcZero-rAb^® Recombinant Antibody for FC

Cat No. PE-FcA98228 Copied!

Clone No. 241808D11

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC

Synonyms

Cd55a, Complement decay-accelerating factor, GPI-anchored, Daf, Daf1, DAF-GPI

• 

  FC experiment of mouse splenocytes using PE-FcA98228

  1x10^6 mouse splenocytes were surface stained with CoraLite® Plus 647 Anti-Mouse CD45R (B220) (RA3-6B2), and 0.1 ug PE Anti-Mouse CD55 Rabbit RecAb (PE-FcA98228, Clone:241808D11) or 0.1 ug PE Rabbit IgG Isotype Control RecAb (PE-FcA98136, Clone: 240953C9). Cells were not fixed.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of mouse splenocytes using PE-FcA98228

  1x10^6 mouse splenocytes were surface stained with 0.1 ug PE Anti-Mouse CD55 Rabbit RecAb (PE-FcA98228, Clone: 241808D11) (red) or 0.1 ug PE Rabbit IgG Isotype Control RecAb (PE-FcA98136, Clone: 240953C9) (blue). Cells were not fixed.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CD55 in ?

Chat with Able

---

Tested Applications

• Positive FC detected in: mouse splenocytes

Recommended dilution

• Flow Cytometry (FC): FC : 0.1 ug per 10^6 cells in a 100 µl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

PE-FcA98228 targets CD55 in FC applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2124

  Product name: Recombinant Mouse CD55 protein (rFc Tag)(HPLC verified)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 35-361 aa of NM_010016.3

  Sequence: DCGPPPDIPNARPILGRHSKFAEQSKVAYSCNNGFKQVPDKSNIVVCLENGQWSSHETFCEKSCVAPERLSFASLKKEYLNMNFFPVGTIVEYECRPGFRKQPPLPGKATCLEDLVWSPVAQFCKKKSCPNPKDLDNGHINIPTGILFGSEINFSCNPGYRLVGVSSTFCSVTGNTVDWDDEFPVCTEIHCPEPPKINNGIMRGESDSYTYSQVVTYSCDKGFILVGNASIYCTVSKSDVGQWSSPPPRCIEKSKVPTKKPTINVPSTGTPSTPQKPTTESVPNPGDQPTPQKPSTVKVSATQHVPVTKTTVRHPIRTSTDKGEPNT

• Full Name: CD55 antigen
• Calculated Molecular Weight: 43kDa
• GenBank Accession Number: NM_010016.3
• Gene Symbol: CD55
• Gene ID (NCBI): 13136
• RRID: AB_3749844
• Conjugate: PE Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 496 nm, 565 nm / 578 nm
• Excitation Laser: Blue Laser (488 nm), Green Laser (532 nm), Yellow-Green Laser (561 nm)
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q61475
• Storage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
• Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

CD55, also known as DAF, is a glycosylphosphatidylinositol (GPI)-anchored surface glycoprotein that is widely distributed on blood, stroma, epithelial, and endothelial cells (PMID: 7517044; 29503741). It can also exist as a soluble form in plasma, urine, saliva, tears, and synovial fluids (PMID: 29503741). CD55 is a complement regulatory protein (PMID: 2469439; 7517044). It inhibits formation of the C3 convertases through binding to C3b and C4b. It also binds the alternate pathway convertase C3bBb, the classical pathway convertase and C4b2a to accelerate their decay (PMID: 17289551). CD55 also serves as a receptor for coxsackieviruses B1, B3, and B5 and several enteroviruses (PMID: 7538177; 7517044).