Tested Applications
| Positive WB detected in | human colostrum, A549 cells, HeLa cells, human milk, MCF-7 cells, HepG2 cells, K-562 cells, Jurkat cells, human placenta tissue |
| Positive IHC detected in | human placenta tissue, human lung cancer tissue, human urothelial carcinoma tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human placenta tissue |
| Positive IF/ICC detected in | BxPC-3 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
68222-1-Ig targets CD59 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | mouse |
| Host / Isotype | Mouse / IgG2b |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag32834 Product name: Recombinant human CD59 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-128 aa of BC001506 Sequence: MGIQGGSVLFGLLLVLAVFCHSGHSLQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLENGGTSLSEKTVLLLVTPFLAAAWSLHP Predict reactive species |
| Full Name | CD59 molecule, complement regulatory protein |
| Calculated Molecular Weight | 19 kDa |
| Observed Molecular Weight | 18-25 kDa |
| GenBank Accession Number | BC001506 |
| Gene Symbol | CD59 |
| Gene ID (NCBI) | 966 |
| RRID | AB_2935310 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P13987 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CD59, also named as MIC11, MIN1, MIN2, MIN3, MSK21, MIRL, MACIF, HRF20 and 1F5 antigen, is a cell surface molecule glycoprotein with MW 18-25 kDa. It acts as a determinant of proximal-distal cell identity. CD59 acts by binding to the C8 and/or C9 complements of the assembling membrane attack complex (MAC), thereby preventing incorporation of the multiple copies of C9 required for complete formation of the osmolytic pore. It is involved in signal transduction for T-cell activation complexed to a protein tyrosine kinase.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CD59 antibody 68222-1-Ig | Download protocol |
| IHC protocol for CD59 antibody 68222-1-Ig | Download protocol |
| WB protocol for CD59 antibody 68222-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The CD59 Monoclonal antibody (1E3A1), catalog number 68222-1-Ig, has 1 total citation. The citation appears in J Mater Sci Mater Med (Impact Factor 4.7), published in 2026. The study investigated cholesterol-depleting nanozymes that amplify membrane-diffusive ferroptosis to potentiate anti-tumor immunity in colorectal cancer. The antibody was used for Western blot in mouse samples. The associated research fields include ferroptosis, tumor immunology, and colorectal cancer.
| Species | Application | Title |
|---|---|---|
J Mater Sci Mater Med Cholesterol-depleting nanozyme amplifies membrane-diffusive ferroptosis for potentiating anti-tumor immunity in colorectal cancer. |
