Tested Applications
| Positive IF-P detected in | human placenta tissue |
| Positive IF/ICC detected in | BxPC-3 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL488-68222 targets CD59 in IF/ICC, IF-P applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Mouse / IgG2b |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag32834 Product name: Recombinant human CD59 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-128 aa of BC001506 Sequence: MGIQGGSVLFGLLLVLAVFCHSGHSLQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLENGGTSLSEKTVLLLVTPFLAAAWSLHP Predict reactive species |
| Full Name | CD59 molecule, complement regulatory protein |
| Calculated Molecular Weight | 19 kDa |
| Observed Molecular Weight | 18-25 kDa |
| GenBank Accession Number | BC001506 |
| Gene Symbol | CD59 |
| Gene ID (NCBI) | 966 |
| RRID | AB_3084446 |
| Conjugate | CoraLite® Plus 488 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P13987 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
CD59, also named as MIC11, MIN1, MIN2, MIN3, MSK21, MIRL, MACIF, HRF20 and 1F5 antigen, is a cell surface molecule glycoprotein with MW 18-25 kDa. It acts as a determinant of proximal-distal cell identity. CD59 acts by binding to the C8 and/or C9 complements of the assembling membrane attack complex (MAC), thereby preventing incorporation of the multiple copies of C9 required for complete formation of the osmolytic pore. It is involved in signal transduction for T-cell activation complexed to a protein tyrosine kinase.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CL Plus 488 CD59 antibody CL488-68222 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
