CoraLite® Plus 647 Anti-Human CD62L Rabbit Recombinant Antibody

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• CoraLite® Plus 647 Anti-Human CD62L Rabbit Recombinant Antibody (CL647-98459-4)

• 

  FC experiment of human PBMCs using CL647-98459-4

  1x10^6 human PBMCs were surface stained with FITC Plus Anti-Human CD4, and 5 ul CoraLite® Plus 647 Anti-Human CD62L Rabbit RecAb (CL647-98459-4, Clone:250646C7) or CoraLite® Plus 647 Rabbit IgG Isotype Control RecAb (CL647-98136, Clone: 240953C9). Cells were incubated with FC Receptor Block prior to staining. Cells were not fixed.

• 

  FC experiment of human PBMCs using CL647-98459-4

  1x10^6 human PBMCs were surface stained with 5 ul CoraLite® Plus 647 Anti-Human CD62L Rabbit RecAb (CL647-98459-4, Clone:250646C7) (red) or CoraLite® Plus 647 Rabbit IgG Isotype Control RecAb (CL647-98136, Clone: 240953C9) (blue). Cells were incubated with FC Receptor Block prior to staining. Cells were not fixed.

CD62L Uni-rAb^® Recombinant Antibody for FC

Cat No. CL647-98459-4

Clone No.250646C7

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC

Synonyms

L-selectin, CD62 antigen-like family member L, gp90 MEL, gp90-MEL, hLHRc

---

Tested Applications

• Positive FC detected in: human PBMCs

Recommended dilution

• Flow Cytometry (FC): FC : 5 ul per 10^6 cells in a 100 µl suspension

This reagent has been pre-titrated and tested for flow cytometric analysis. The suggested use of this reagent is 5 ul per 10^6 cells in a 100 µl suspension or 5 ul per 100 µl of whole blood.

Sample-dependent, Check data in validation data gallery.

Product Information

CL647-98459-4 targets CD62L in FC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3006

  Product name: Recombinant Human L-selectin/CD62L protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 39-332 aa of NM_000655.5

  Sequence: WTYHYSEKPMNWQRARRFCRDNYTDLVAIQNKAEIEYLEKTLPFSRSYYWIGIRKIGGIWTWVGTNKSLTEEAENWGDGEPNNKKNKEDCVEIYIKRNKDAGKWNDDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQFVIQCEPLEAPELGTMDCTHPLGNFSFSSQCAFSCSEGTNLTGIEETTCGPFGNWSSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFSFTSACTFICSEGTELIGKKKTICESSGIWSNPSPICQKLDKSFSMIKEGDYN

• Full Name: selectin L
• Calculated Molecular Weight: 42 kDa
• GenBank Accession Number: NM_000655.5
• Gene Symbol: CD62L
• Gene ID (NCBI): 6402
• ENSEMBL Gene ID: ENSG00000188404
• RRID: AB_3748877
• Conjugate: CoraLite® Plus 647 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 654 nm / 674 nm
• Excitation Laser: Red Laser (633 nm)
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P14151-1
• Storage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
• Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

CD62L, also known as L-selectin or SELL, is a member of the selectin family of adhesion molecules that also include CD62E (E-selectin) and CD62P (P-selectin) (PMID: 2663882, 2473156, 1382078). CD62L is a highly glycosylated protein of 95-105 kDa on neutrophils and 74 kDa on lymphocytes (PMID: 1382078; 1694883, 1695155). CD62L is expressed on the surface of most leukocytes, including lymphocytes, neutrophils, monocytes, eosinophils, hematopoietic progenitor cells, and immature thymocytes (PMID: 1694883, 1688580). It mediates the binding of lymphocytes to high endothelial venules (HEV) of peripheral lymph nodes through interactions with a constitutively expressed ligand, and is also involved in lymphocyte, neutrophil, and monocyte attachment to endothelium at sites of inflammation (PMID: 1382078).