CoraLite® Plus 488-conjugated CD63 Recombinant monoclonal antibody

• 

  IF Staining of A431 using CL488-84507-4

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using CoraLite® Plus 488 CD63 antibody (CL488-84507-4, Clone: 241964H1 ) at dilution of 1:500, CL594-Phalloidin (red).

• 

  IF Staining of HepG2 using CL488-84507-4

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using CoraLite® Plus 488 CD63 antibody (CL488-84507-4, Clone: 241964H1 ) at dilution of 1:500, CL594-Phalloidin (red).

CD63 Uni-rAb^® Recombinant Antibody for IF/ICC

Cat No. CL488-84507-4

Clone No.241964H1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

Synonyms

241964H1, CD 63, CD63 antigen, Limp1, Lysosomal-associated membrane protein 3

---

Tested Applications

• Positive IF/ICC detected in: A431 cells, HepG2 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-84507-4 targets CD63 in IF/ICC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2064

  Product name: Recombinant Human CD63 protein (rFc Tag)(HPLC verified)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 103-203 aa of BC002349

  Sequence: AGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNV

• Full Name: CD63 molecule
• Calculated Molecular Weight: 26 kDa
• GenBank Accession Number: BC002349
• Gene Symbol: CD63
• Gene ID (NCBI): 967
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P08962
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

CD63 is a 30-60 kDa lysosomal membrane protein that belongs to the tetraspanin family. This protein plays many important roles in immuno-physiological functions. It mediates signal transduction events that regulate cell development, activation, growth, and motility. CD63 is expressed on activated platelets, thus it may function as a blood platelet activation marker. CD63 is a lysosomal membrane glycoprotein translocated to the plasma membrane after platelet activation. The CD63 tetraspanin is highly expressed in the early stages of melanoma and decreases in advanced lesions, suggesting it is a possible suppressor of tumor progression. Deficiency of this protein is associated with Hermansky-Pudlak syndrome.