CoraLite®594 Anti-Human CD63 Rabbit scFv Antibody

• Home
• Products
• Primary Antibodies
• CoraLite®594 Anti-Human CD63 Rabbit scFv Antibody (CL594-SF98318)

• Site-specific conjugation

CD63 Recombinant Antibody for FC

Cat No. CL594-SF98318

Clone No.241964E1

Host / Type

Rabbit / scFv

Reactivity

human

Applications

FC

Synonyms

CD 63, CD63 antigen, Limp1, Lysosomal-associated membrane protein 3, Lysosome integral membrane protein 1

• 

  FC experiment of human peripheral blood platelets using CL594-SF98318

  1x10^6 thrombin treated human peripheral blood platelets were surface stained with 0.25 ug CoraLite®594 Anti-Human CD63 Rabbit scFv Antibody (CL594-SF98318, Clone: 241964E1) (red) or FcZero-rAb® CoraLite® Plus 594 Rabbit IgG Isotype Control Recombinant Antibody (CL594-FcA98136, Clone: 240953C9) (blue). 1x10^6 untreated human peripheral blood platelets were surface stained with 0.25 ug CoraLite®594 Anti-Human CD63 Rabbit scFv Antibody (CL594-SF98318, Clone: 241964E1) (black, dashed). Cells were not fixed.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive FC detected in: Thrombin treated human peripheral blood platelets

Recommended dilution

• Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL594-SF98318 targets CD63 in FC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Type: Rabbit / scFv
• Class: Recombinant
• Type: Single-chain variable fragment antibody (scFv)
• Immunogen:

  CatNo: Eg2064

  Product name: Recombinant Human CD63 protein (rFc Tag)(HPLC verified)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 103-203 aa of BC002349

  Sequence: AGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNV

• Full Name: CD63 molecule
• Calculated Molecular Weight: 26 kDa
• GenBank Accession Number: BC002349
• Gene Symbol: CD63
• Gene ID (NCBI): 967
• Conjugate: CoraLite®594 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 588 nm / 604 nm
• Excitation Laser: Yellow-Green Laser (561 nm)
• Source: Anti-Human CD63 scFv from clone 241964E1, consisting of VH-GGGGS linker-VL (N- to C-terminus), with a His tag at the C-terminus.
• Form: Liquid
• Purification Method: Affinity purification
• Storage Buffer: 50mM HEPES, 150mM NaCl, 5mM EDTA, 0.1% CHAPS, 10% Sucrose and 0.1% Proclin300, pH 7.3.
• Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment. 20ul sizes contain 0.1% BSA.

Background Information

CD63 is a 30-60 kDa lysosomal membrane protein that belongs to the tetraspanin family. This protein plays many important roles in immuno-physiological functions. It mediates signal transduction events that regulate cell development, activation, growth, and motility. CD63 is expressed on activated platelets, thus it may function as a blood platelet activation marker. CD63 is a lysosomal membrane glycoprotein translocated to the plasma membrane after platelet activation. The CD63 tetraspanin is highly expressed in the early stages of melanoma and decreases in advanced lesions, suggesting it is a possible suppressor of tumor progression. Deficiency of this protein is associated with Hermansky-Pudlak syndrome.