CD68 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 84596-4-RR (same clone as 84596-4-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84596-4-RR (CD68 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84596-4-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 84596-4-RR (same clone as 84596-4-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 84596-4-RR (CD68 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84596-4-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 84596-4-RR (same clone as 84596-4-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 84596-4-RR (CD68 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84596-4-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse spleen using 84596-4-RR (same clone as 84596-4-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 84596-4-RR (CD68 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84596-4-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse spleen using 84596-4-RR (same clone as 84596-4-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 84596-4-RR (CD68 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84596-4-PBS in a different storage buffer formulation.

• 

  IF Staining of human tonsillitis using 84596-4-RR (same clone as 84596-4-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human tonsillitis tissue using CD68 antibody (84596-4-RR, Clone: 241810B3 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84596-4-PBS in a different storage buffer formulation.

CD68 Uni-rAb^® Recombinant Antibody for WB, IHC, IF-P, Indirect ELISA

Cat No. 84596-4-PBS

Clone No.241810B3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF-P, Indirect ELISA

Synonyms

241810B3, CD68 molecule, GP110, Macrosialin, SCARD1

---

Product Information

84596-4-PBS targets CD68 in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2061

  Product name: Recombinant Human CD68 protein (rFc Tag)(HPLC verified)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 22-319 aa of BC015557

  Sequence: NDCPHKKSATLLPSFTVTPTVTESTGTTSHRTTKSHKTTTHRTTTTGTTSHGPTTATHNPTTTSHGNVTVHPTSNSTATSQGPSTATHSPATTSHGNATVHPTSNSTATSPGFTSSAHPEPPPPSPSPSPTSKETIGDYTWTNGSQPCVHLQAQIQIRVMYTTQGGGEAWGISVLNPNKTKVQGSCEGAHPHLLLSFPYGHLSFGFMQDLQQKVVYLSYMAVEYNVSFPHAAQWTFSAQNASLRDLQAPLGQSFSCSNSSIILSPAVHLDLLSLRLQAAQLPHTGVFGQSFSCPSDRS

• Full Name: CD68 molecule
• Calculated Molecular Weight: 37 kDa
• Observed Molecular Weight: 80-90 kDa
• GenBank Accession Number: BC015557
• Gene Symbol: CD68
• Gene ID (NCBI): 968
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P34810
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CD68 is a type I transmembrane glycoprotein that is highly expressed by human monocytes and tissue macrophages. It belongs to the lysosomal/endosomal-associated membrane glycoprotein (LAMP) family and primarily localizes to lysosomes and endosomes with a smaller fraction circulating to the cell surface. CD68 is also a member of the scavenger receptor family. It may play a role in the phagocytic activities of tissue macrophages.