CD68 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• CD68 Recombinant monoclonal antibody (84596-4-RR)

CD68 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 84596-4-RR Copied!

Clone No. 241810B3

Publications (2)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

241810B3, CD68 molecule, GP110, Macrosialin, SCARD1

• 

  WB analysis using 84596-4-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 84596-4-RR (CD68 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CD68 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: J774A.1 cells, U-937 cells, RAW 264.7 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

84596-4-RR targets CD68 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2061

  Product name: Recombinant Human CD68 protein (rFc Tag)(HPLC verified)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 22-319 aa of BC015557

  Sequence: NDCPHKKSATLLPSFTVTPTVTESTGTTSHRTTKSHKTTTHRTTTTGTTSHGPTTATHNPTTTSHGNVTVHPTSNSTATSQGPSTATHSPATTSHGNATVHPTSNSTATSPGFTSSAHPEPPPPSPSPSPTSKETIGDYTWTNGSQPCVHLQAQIQIRVMYTTQGGGEAWGISVLNPNKTKVQGSCEGAHPHLLLSFPYGHLSFGFMQDLQQKVVYLSYMAVEYNVSFPHAAQWTFSAQNASLRDLQAPLGQSFSCSNSSIILSPAVHLDLLSLRLQAAQLPHTGVFGQSFSCPSDRS

• Full Name: CD68 molecule
• Calculated Molecular Weight: 37 kDa
• Observed Molecular Weight: 80-90 kDa
• GenBank Accession Number: BC015557
• Gene Symbol: CD68
• Gene ID (NCBI): 968
• RRID: AB_3743595
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P34810
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD68 is a type I transmembrane glycoprotein that is highly expressed by human monocytes and tissue macrophages. It belongs to the lysosomal/endosomal-associated membrane glycoprotein (LAMP) family and primarily localizes to lysosomes and endosomes with a smaller fraction circulating to the cell surface. CD68 is also a member of the scavenger receptor family. It may play a role in the phagocytic activities of tissue macrophages.

Publications

What published studies show

The CD68 Recombinant monoclonal antibody (241810B3), catalog number 84596-4-RR, has 2 total citations. These appear in Research (Wash D C) and Hear Res. The cited research fields include pulmonary fibrosis and lung injury (monocyte-derived macrophages and matrix remodeling) and age-related hearing loss (progranulin expression in cochlear microglia-like cells).

Automatically generated from the 2 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Research (Wash D C); Monocyte-Derived LGMN(+) Macrophages Divert Lung Injury Outcomes toward Fibrosis through Matrix Remodeling.; Authors - Zhongzheng Li
		Hear Res; The decline of progranulin expression in cochlear Microglia-Like Cells accelerates the progression of age-related hearing loss.; Authors - Qi Li