CoraLite® Plus 488 Anti-Human CD68 Rabbit scFv Antibody

• Home
• Products
• Primary Antibodies
• CoraLite® Plus 488 Anti-Human CD68 Rabbit scFv Antibody (CL488-SF98242)

• Site-specific conjugation

CD68 Recombinant Antibody for FC

Cat No. CL488-SF98242

Clone No.241810G1

Host / Type

Rabbit / scFv

Reactivity

human

Applications

FC

Synonyms

CD68 molecule, GP110, Macrosialin, SCARD1

• 

  FC experiment of human PBMCs using CL488-SF98242

  1x10^6 human PBMCs were surface stained with CoraLite® Plus 594 Anti-Human CD14, and 0.25 ug CoraLite® Plus 488 Anti-Human CD68 Rabbit scFv Antibody (CL488-SF98242, Clone: 241810G1) or unstained. Cells were not fixed.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of human PBMCs using CL488-SF98242

  1x10^6 human PBMCs were surface stained with 0.25 ug CoraLite® Plus 488 Anti-Human CD68 Rabbit scFv Antibody (CL488-SF98242, Clone: 241810G1) (red), or unstained (blue). Cells were not fixed.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive FC detected in: human PBMCs

Recommended dilution

• Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-SF98242 targets CD68 in FC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Type: Rabbit / scFv
• Class: Recombinant
• Type: Single-chain variable fragment antibody (scFv)
• Immunogen:

  CatNo: Eg2061

  Product name: Recombinant Human CD68 protein (rFc Tag)(HPLC verified)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 22-319 aa of BC015557

  Sequence: NDCPHKKSATLLPSFTVTPTVTESTGTTSHRTTKSHKTTTHRTTTTGTTSHGPTTATHNPTTTSHGNVTVHPTSNSTATSQGPSTATHSPATTSHGNATVHPTSNSTATSPGFTSSAHPEPPPPSPSPSPTSKETIGDYTWTNGSQPCVHLQAQIQIRVMYTTQGGGEAWGISVLNPNKTKVQGSCEGAHPHLLLSFPYGHLSFGFMQDLQQKVVYLSYMAVEYNVSFPHAAQWTFSAQNASLRDLQAPLGQSFSCSNSSIILSPAVHLDLLSLRLQAAQLPHTGVFGQSFSCPSDRS

• Full Name: CD68 molecule
• Calculated Molecular Weight: 37 kDa
• GenBank Accession Number: BC015557
• Gene Symbol: CD68
• Gene ID (NCBI): 968
• RRID: AB_3748009
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Excitation Laser: Blue laser (488 nm)
• Source: Anti-Human CD68 scFv from clone 241810G1, consisting of VH-GGGGS linker-VL (N- to C-terminus), with a His tag at the C-terminus.
• Form: Liquid
• Purification Method: Affinity purification
• Storage Buffer: 50mM HEPES, 150mM NaCl, 5mM EDTA, 0.1% CHAPS, 10% Sucrose and 0.1% Proclin300, pH 7.3.
• Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment. 20ul sizes contain 0.1% BSA.

Background Information

CD68 is a type I transmembrane glycoprotein that is highly expressed by human monocytes and tissue macrophages. It belongs to the lysosomal/endosomal-associated membrane glycoprotein (LAMP) family and primarily localizes to lysosomes and endosomes with a smaller fraction circulating to the cell surface. CD68 is also a member of the scavenger receptor family. It may play a role in phagocytic activities of tissue macrophages.