Use Able AI chat for product recommendations

PerCP-Cyanine5.5 Anti-Mouse CD69 Rabbit Recombinant Antibody

CD69 Uni-rAb® Recombinant Antibody for FC

Cat No. CPY5-98440-2
Clone No.250269C11

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC

AIM, CD69 antigen, VEA

Formulation:  PBS, Azide, BSA
PBS, Azide, BSA
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC detected inCD3/CD28 treated mouse splenocytes

Recommended dilution

ApplicationDilution
Flow Cytometry (FC)FC : 0.25 ug per 10^6 cells in a 100 µl suspension
This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CPY5-98440-2 targets CD69 in FC applications and shows reactivity with mouse samples.

Tested Reactivity mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg3835

Product name: Recombinant Mouse CD69 protein (rFc Tag) (HPLC verified)

Source: mammalian cells-derived, pHZ-KIsec-N-rFc

Tag: N-rFc

Domain: 62-199 aa of NM_001033122.3

Sequence: NVGKYNCPGLYEKLESSDHHVATCKNEWISYKRTCYFFSTTTKSWALAQRSCSEDAATLAVIDSEKDMTFLKRYSGELEHWIGLKNEANQTWKWANGKEFNSWFNLTGSGRCVSVNHKNVTAVDCEANFHWVCSKPSR

Predict reactive species
Full Name CD69 antigen
Calculated Molecular Weight23 kDa
GenBank Accession NumberNM_001033122.3
Gene Symbol Cd69
Gene ID (NCBI) 12515
Conjugate PerCP-Cyanine5.5 Fluorescent Dye
Excitation/Emission Maxima Wavelengths482 nm / 690nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP37217
Storage Buffer PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
Storage ConditionsStore at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

CD69, also known as AIM, EA-1, Leu-23, and MLR3, is a type II transmembrane glycoprotein that belongs to the C-type lectin superfamily (PMID: 8340758; 7804122). CD69 is constitutively expressed by mature thymocytes, platelets, several subsets of tissue resident immune cells (including resident memory T cells and gamma delta T cells), and is inducibly expressed by activated T cells, B cells, natural killer (NK) cells, monocytes, neutrophils (PMID: 8100776; 28475283). CD69 has been identified as an early activation marker of lymphocytes and is commonly used as a marker of activated lymphocytes and NK cells (PMID: 28475283; 25759842). It is involved in the regulation of immune responses (PMID: 15745855).

Protocols

Product Specific Protocols
FC protocol for PerCP-Cyanine5.5 CD69 antibody CPY5-98440-2Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...