Anti-Human CD7 Rabbit Recombinant Antibody, PBS Only

• 

  FC experiment of human PBMCs using 98204-1-RR (same clone as 98204-1-PBS)

  1x10^6 human PBMCs were surface stained with 0.25 ug Anti-Human CD7 Rabbit Recombinant Antibody (98204-1-RR, Clone: 242402H8) or Rabbit IgG Isotype Control Recombinant Antibody (98136-1-RR, Clone: 240953C9), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were co-stained with APC Anti-Human CD4. Cells were not fixed. Lymphocytes were gated. This data was developed using the same antibody clone with 98204-1-PBS in a different storage buffer formulation.

• 

  FC experiment of human PBMCs using 98204-1-RR (same clone as 98204-1-PBS)

  1x10^6 human PBMCs were surface stained with 0.25 ug Anti-Human CD7 Rabbit Recombinant Antibody (98204-1-RR, Clone: 242402H8) (red) or Rabbit IgG Isotype Control Recombinant Antibody (98136-1-RR, Clone: 240953C9) (blue), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were not fixed. This data was developed using the same antibody clone with 98204-1-PBS in a different storage buffer formulation.

CD7 Uni-rAb^® Recombinant Antibody for FC

Cat No. 98204-1-PBS

Clone No.242402H8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC

Synonyms

242402H8, CD7 molecule, GP40, LEU-9, T cell antigen CD7

---

Product Information

98204-1-PBS targets CD7 in FC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3034

  Product name: Recombinant Human CD7 protein (rFc Tag)(HPLC verified)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 26-180 aa of NM_006137.7

  Sequence: AQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALP

• Full Name: CD7 molecule
• Calculated Molecular Weight: 25 kDa
• GenBank Accession Number: NM_006137.7
• Gene Symbol: CD7
• Gene ID (NCBI): 924
• ENSEMBL Gene ID: ENSG00000173762
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P09564
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CD7, also known as Leu-9 or GP40, is a 40-kDa single-pass type I transmembrane glycoprotein belonging to the immunoglobulin superfamily. CD7 is expressed on thymocytes, T cells, NK cells, and cells in the early stages of T, B, and myeloid cell differentiation (PMID: 10530432). It is one of the earliest antigens to appear on cells of the T-lymphocyte lineage (PMID: 3501369). CD7 plays a significant role in T-cell and T-cell/B-cell interactions during early lymphoid development. It is involved in the regulation of cell signaling and biology, including T-cell activation, proliferation, and the expression of interleukin-2 receptor alpha (IL-2Rα) (PMID: 11485208). CD7 is not only a marker for T-cells but also has functional implications in immune cell interactions and adhesion. It can provide co-stimulatory signals and is associated with CD3 and CD45, participating in T-cell activation (PMID: 7523512).