Anti-Human CD7 Rabbit Recombinant Antibody

CD7 Uni-rAb® Recombinant Antibody for FC
Cat No. 98204-1-RR
Clone No.242402H8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC

242402H8, CD7 molecule, GP40, LEU-9, T cell antigen CD7

Formulation:  PBS, Azide
PBS, Azide
PBS Only
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC detected inhuman PBMCs

Recommended dilution

ApplicationDilution
Flow Cytometry (FC)FC : 0.25 ug per 10^6 cells in 100 μl suspension
This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

98204-1-RR targets CD7 in FC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg3034

Product name: Recombinant Human CD7 protein (rFc Tag)(HPLC verified)

Source: mammalian cells-derived, V37

Tag: C-rFc

Domain: 26-180 aa of NM_006137.7

Sequence: AQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALP

Predict reactive species
Full Name CD7 molecule
Calculated Molecular Weight25 kDa
GenBank Accession NumberNM_006137.7
Gene Symbol CD7
Gene ID (NCBI) 924
ENSEMBL Gene IDENSG00000173762
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDP09564
Storage Buffer PBS with 0.09% sodium azide, pH 7.3.
Storage ConditionsStore at 2 - 8°C. Stable for one year after shipment.

Background Information

CD7, also known as Leu-9 or GP40, is a 40-kDa single-pass type I transmembrane glycoprotein belonging to the immunoglobulin superfamily. CD7 is expressed on thymocytes, T cells, NK cells, and cells in the early stages of T, B, and myeloid cell differentiation (PMID: 10530432). It is one of the earliest antigens to appear on cells of the T-lymphocyte lineage (PMID: 3501369). CD7 plays a significant role in T-cell and T-cell/B-cell interactions during early lymphoid development. It is involved in the regulation of cell signaling and biology, including T-cell activation, proliferation, and the expression of interleukin-2 receptor alpha (IL-2Rα) (PMID: 11485208). CD7 is not only a marker for T-cells but also has functional implications in immune cell interactions and adhesion. It can provide co-stimulatory signals and is associated with CD3 and CD45, participating in T-cell activation (PMID: 7523512).

Protocols

Product Specific Protocols
FC protocol for CD7 antibody 98204-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...