FcZero-rAb® Biotin Anti-Mouse CD70 Rabbit Recombinant Antibody

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• FcZero-rAb® Biotin Anti-Mouse CD70 Rabbit Recombinant Antibody (Biotin-FcA98212)

• Zero Fc receptor binding
• Site-specific conjugation
• One universal isotype

CD70 FcZero-rAb^® Recombinant Antibody for FC

Cat No. Biotin-FcA98212 Copied!

Clone No. 241553F2

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC

Synonyms

CD27 ligand, Cd27l, CD27-L, Cd27lg, CD70 antigen

• 

  FC experiment of mouse splenocytes using Biotin-FcA98212

  1x10^6 untreated or LPS-treated mouse splenocytes were surface stained with 0.25 ug Biotin Anti-Mouse CD70 Rabbit RecAb (Biotin-FcA98212, Clone: 241553F2) and Streptavidin-PE Conjugate (PE-PF00030). Cells were not fixed.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of mouse splenocytes using Biotin-FcA98212

  1x10^6 LPS-treated mouse splenocytes were surface stained with 0.25 ug Biotin Anti-Mouse CD70 Rabbit RecAb (Biotin-FcA98212, Clone: 241553F2) (red) or FcZero-rAb® Biotin Rabbit IgG Isotype Control Recombinant Antibody (Biotin-FcA98136, Clone: 240953C9) (blue), and Streptavidin-PE Conjugate (PE-PF00030). 1x10^6 untreated mouse splenocytes were surface stained with 0.25 ug Biotin Anti-Mouse CD70 Rabbit RecAb (Biotin-FcA98212, Clone: 241553F2) (black, dashed) and Streptavidin-PE Conjugate (PE-PF00030). Cells were not fixed.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CD70 in ?

Chat with Able

---

Tested Applications

• Positive FC detected in: LPS treated mouse splenocytes

Recommended dilution

• Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

Biotin-FcA98212 targets CD70 in FC applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1294

  Product name: Recombinant Mouse CD70 protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: N-6*His

  Domain: 45-195 aa of NM_011617.2

  Sequence: SKQQQRLLEHPEPHTAELQLNLTVPRKDPTLRWGAGPALGRSFTHGPELEEGHLRIHQDGLYRLHIQVTLANCSSPGSTLQHRATLAVGICSPAAHGISLLRGRFGQDCTVALQRLTYLVHGDVLCTNLTLPLLPSRNADETFFGVQWICP

• Full Name: CD70 antigen
• Calculated Molecular Weight: 22 kDa
• GenBank Accession Number: NM_011617.2
• Gene Symbol: Cd70
• Gene ID (NCBI): 21948
• RRID: AB_3746974
• Conjugate: Biotin
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O55237
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

CD70, also known as tumor necrosis factor ligand superfamily member 7 (TNFSF7) or CD27 ligand (CD27L), is a transmembrane protein that plays a significant role in the immune system. It is the unique ligand for CD27, a member of the tumor necrosis factor receptor (TNFR) family, and is transiently upregulated upon stimulation of immune cells. CD70 is expressed on lymphocytes and dendritic cells, and its expression can be regulated by activation signals received via toll-like receptors (TLRs), CD40, and the antigen receptor MHC II. It provides complex and not completely understood signaling for B cell development. CD70 is also expressed on various solid tumors and hematolymphoid malignancies, where it may contribute to a poor prognosis. (PMID: 34991665; 26213107; 26098609)