CoraLite® Plus 488-conjugated CD70 Monoclonal antibody

CD70 Monoclonal Antibody for IF-P
Cat No. CL488-67749
Clone No.1A11A10

Host / Isotype

Mouse / IgG1

Reactivity

Human

Applications

IF-P

CD27 L, CD27 ligand, CD27L, CD27LG, CD70, CD70 antigen, CD70 molecule, TNFSF7

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inhuman tonsillitis tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67749 targets CD70 in IF-P applications and shows reactivity with Human samples.

Tested Reactivity Human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag28070

Product name: Recombinant human CD70 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-193 aa of BC000725

Sequence: MPEEGSGCSVRRRPYGCVLRAALVPLVAGLVICLVVCIQRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP

Predict reactive species
Full Name CD70 molecule
Calculated Molecular Weight 21 kDa
GenBank Accession NumberBC000725
Gene Symbol CD70
Gene ID (NCBI) 970
RRIDAB_2919536
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP32970
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 CD70 antibody CL488-67749Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...