Mouse CD79a Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Mouse CD79a Polyclonal antibody, PBS Only (31887-1-PBS)

• 

  WB analysis using 31887-1-AP (same clone as 31887-1-PBS)

  Mouse spleen tissue was subjected to SDS PAGE, followed by western blot with 31887-1-AP (CD79a antibody) at a dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31887-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse spleen using 31887-1-AP (same clone as 31887-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 31887-1-AP (CD79A antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31887-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse spleen using 31887-1-AP (same clone as 31887-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 31887-1-AP (CD79A antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31887-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat spleen using 31887-1-AP (same clone as 31887-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat spleen tissue slide using 31887-1-AP (CD79A antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31887-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat spleen using 31887-1-AP (same clone as 31887-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat spleen tissue slide using 31887-1-AP (CD79A antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31887-1-PBS in a different storage buffer formulation.

• 

  IF Staining of rat spleen using 31887-1-AP (same clone as 31887-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded rat spleen tissue using CD79a antibody (31887-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31887-1-PBS in a different storage buffer formulation.

CD79a Polyclonal Antibody for WB, IHC, IF-P, Indirect ELISA

Cat No. 31887-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, IHC, IF-P, Indirect ELISA

Synonyms

B-cell antigen receptor complex-associated protein alpha chain, Mb-1

---

Product Information

31887-1-PBS targets CD79a in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with mouse, rat samples.

• Tested Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Eg1388

  Product name: Recombinant Mouse CD79A protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 29-137 aa of NM_007655.3

  Sequence: LRVEGGPPSLTVNLGEEARLTCENNGRNPNITWWFSLQSNITWPPVPLGPGQGTTGQLFFPEVNKNHRGLYWCQVIENNILKRSCGTYLRVRNPVPRPFLDMGEGTKNR

• Full Name: CD79A antigen (immunoglobulin-associated alpha)
• Calculated Molecular Weight: 25 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: NM_007655.3
• Gene Symbol: Cd79a
• Gene ID (NCBI): 12518
• RRID: AB_3670132
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P11911
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CD79a, also named as B-cell antigen receptor complex-associated protein alpha chain or MB-1 membrane glycoprotein, is a 226 amino acid protein, which contains one ITAM domain and one Ig-like C2-type (immunoglobulin-like) domain. CD79A is expressed in B cell and localizes in the cell membrane. CD79A is required in cooperation with CD79B for initiation of the signal transduction cascade activated by binding of antigen to the B-cell antigen receptor complex (BCR) which leads to internalization of the complex, trafficking to late endosomes and antigen presentation. CD79A is also required for BCR surface expression and for efficient differentiation of pro- and pre-B-cells.