FcZero-rAb® Biotin Anti-Mouse CD79b Rabbit Recombinant Antibody

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• FcZero-rAb® Biotin Anti-Mouse CD79b Rabbit Recombinant Antibody (Biotin-FcA98217)

• Zero Fc receptor binding
• Site-specific conjugation
• One universal isotype

CD79b FcZero-rAb^® Recombinant Antibody for FC, ELISA

Cat No. Biotin-FcA98217 Copied!

Clone No. 241850D10

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC, ELISA

Synonyms

B-cell antigen receptor complex-associated protein beta chain, B-cell-specific glycoprotein B29, Igb, Ig-beta, Immunoglobulin-associated B29 protein

• 

  FC experiment of mouse bone marrow cells using Biotin-FcA98217

  1x10^6 mouse bone marrow cells were surface stained with APC Anti-Mouse CD45R (B220) (RA3-6B2) (APC-65139, Clone: RA3-6B2), and 0.25 ug Biotin Anti-Mouse CD79b Rabbit RecAb (Biotin-FcA98217, Clone: 241850D10) or Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9), and Streptavidin-PE Conjugate (PE-PF00030). Cells were not fixed.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of mouse bone marrow cells using Biotin-FcA98217

  1x10^6 mouse bone marrow cells were surface stained with 0.25 ug Biotin Anti-Mouse CD79b Rabbit RecAb (Biotin-FcA98217, Clone: 241850D10) (red) or Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue), and Streptavidin-PE Conjugate (PE-PF00030). Cells were not fixed.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CD79b in ?

Chat with Able

---

Tested Applications

• Positive FC detected in: mouse bone marrow cells

Recommended dilution

• Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

Biotin-FcA98217 targets CD79b in FC, ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2113

  Product name: Recombinant Mouse CD79B protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 26-158 aa of NM_008339.3

  Sequence: VPAMTSSDLPLNFQGSPCSQIWQHPRFAAKKRSSMVKFHCYTNHSGALTWFRKRGSQQPQELVSEEGRIVQTQNGSVYTLTIQNIQYEDNGIYFCKQKCDSANHNVTDSCGTELLVLGFSTLDQLKRRNTLKD

• Full Name: CD79B antigen
• Calculated Molecular Weight: 26 kDa
• GenBank Accession Number: NM_008339.3
• Gene Symbol: Cd79b
• Gene ID (NCBI): 15985
• RRID: AB_3746978
• Conjugate: Biotin
• Excitation/Emission Maxima Wavelengths: -
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P15530
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

CD79 molecule encompasses two transmembrane proteins, CD79a and CD79b, which form a disulfide-linked heterodimer and are members of the immunoglobulin (Ig) gene superfamily (PMID: 2033258; 1375264; 2304550). CD79b molecule (also known as B29, IGB, AGM6, and Igbeta) is expressed almost exclusively on B cells and B-cell neoplasms, influencing antigen internalization and increasing antigen presentation efficiency (PMID: 7552998). CD79b mutation could be a key biomarker for DLBCL disease progression (PMID: 36182550).