Mouse CD80 Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• Mouse CD80 Recombinant monoclonal antibody, PBS Only (84137-5-PBS)

CD80 Uni-rAb^® Recombinant Antibody for WB, IHC, Indirect ELISA

Cat No. 84137-5-PBS

Clone No.241371E10

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

241371E10, B7 1, B7.1, Cd28l, CD80 antigen

• 

  WB analysis of mouse spleen using 84137-5-RR (same clone as 84137-5-PBS)

  mouse spleen tissue was subjected to SDS PAGE followed by western blot with 84137-5-RR (CD80/B7-1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84137-5-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse spleen using 84137-5-RR (same clone as 84137-5-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 84137-5-RR (CD80 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84137-5-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Affinity and Kinetic Characterization of 84137-5-RR

  Biolayer interferometry (BLl) kinetic assays of 84137-5-RR against Mouse CD80/B7-1 were performed. The affinity constant is 0.204 nM.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

84137-5-PBS targets CD80 in WB, IHC, Indirect ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg0840

  Product name: Recombinant Mouse CD80 protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 38-246 aa of NM_009855.2

  Sequence: VDEQLSKSVKDKVLLPCRYNSPHEDESEDRIYWQKHDKVVLSVIAGKLKVWPEYKNRTLYDNTTYSLIILGLVLSDRGTYSCVVQKKERGTYEVKHLALVKLSIKADFSTPNITESGNPSADTKRITCFASGGFPKPRFSWLENGRELPGINTTISQDPESELYTISSQLDFNTTRNHTIKCLIKYGDAHVSEDFTWEKPPEDPPDSKN

• Full Name: CD80 antigen
• Calculated Molecular Weight: 35 kDa
• Observed Molecular Weight: 60 kDa
• GenBank Accession Number: NM_009855.2
• Gene Symbol: CD80
• Gene ID (NCBI): 12519
• RRID: AB_3671696
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q00609-1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CD80 (also known as B7-1) is a type I membrane protein that is a member of the immunoglobulin superfamily, with an extracellular immunoglobulin constant-like domain and a variable-like domain required for receptor binding. It is expressed on antigen-presenting cells (APCs), including B cells, dendritic cells, monocytes, and macrophages. CD80 is the receptor for the proteins CD28 and CTLA-4 found on the surface of T-cells. It is involved in the costimulatory signal essential for T-lymphocyte activation. T-cell proliferation and cytokine production is induced by the binding of CD28, binding to CTLA-4 has opposite effects and inhibits T-cell activation. CD80 also acts as a cellular attachment receptor for adenovirus subgroup B. (PMID: 7545666; 12015893; 16920215)