FcZero-rAb® Biotin Anti-Human CD81 Rabbit Recombinant Antibody

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• FcZero-rAb® Biotin Anti-Human CD81 Rabbit Recombinant Antibody (Biotin-FcA98202)

• Zero Fc receptor binding
• Site-specific conjugation
• One universal isotype

CD81 FcZero-rAb^® Recombinant Antibody for FC, ELISA

Cat No. Biotin-FcA98202

Clone No.241722G4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC, ELISA

Synonyms

26 kDa cell surface protein TAPA-1, CD81 antigen, CD81 molecule, S5.7, TAPA1

• 

  FC experiment of human peripheral blood leukocytes using Biotin-FcA98202

  1x10^6 human peripheral blood leukocytes were surface stained with 0.25 ug Biotin Anti-Human CD81 Rabbit RecAb (Biotin-FcA98202, Clone: 241722G4) or FcZero-rAb™ Biotin Rabbit IgG Isotype Control Recombinant Antibody (Biotin-FcA98136, Clone: 240953C9), and Streptavidin-PE Conjugate (Cat.No. PE-PF00030). Cells were not fixed.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of human peripheral blood leukocytes using Biotin-FcA98202

  1x10^6 human peripheral blood leukocytes were surface stained with 0.25 ug Biotin Anti-Human CD81 Rabbit RecAb (Biotin-FcA98202, Clone: 241722G4) (red) or FcZero-rAb™ Biotin Rabbit IgG Isotype Control Recombinant Antibody (Biotin-FcA98136, Clone: 240953C9) (blue), and Streptavidin-PE Conjugate (Cat.No. PE-PF00030). Cells were not fixed.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive FC detected in: human peripheral blood leukocytes

Recommended dilution

• Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

Biotin-FcA98202 targets CD81 in FC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1036

  Product name: recombinant human CD81 protein

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: N-6*His

  Domain: 113-201 aa of NM_004356.4

  Sequence: FVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGK

• Full Name: CD81 molecule
• Calculated Molecular Weight: 26 kDa
• GenBank Accession Number: NM_004356.4
• Gene Symbol: CD81
• Gene ID (NCBI): 975
• ENSEMBL Gene ID: ENSG00000110651
• RRID: AB_3746969
• Conjugate: Biotin
• Excitation/Emission Maxima Wavelengths: -
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P60033
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

CD81 (also known as TAPA1 or TSPAN28) is a membrane protein of the tetraspanin superfamily, which are characterized by the presence of four conserved transmembrane regions. Many of these members are expressed on leukocytes and have been implicated in signal transduction, cell-cell interactions, and cellular activation and development. CD81 is involved in signal transduction and cell adhesion in the immune system (PMID: 9597125). CD81 has also been identified as an essential receptor for HCV (hepatitis C virus) (PMID: 21428934).