CD83 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CD83 Polyclonal antibody, PBS Only (27873-1-PBS)

• 

  WB analysis using 27873-1-AP (same clone as 27873-1-PBS)

  Untreated and PNGF treated Raji cells were subjected to SDS PAGE followed by western blot with 27873-1-AP (CD83 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27873-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 27873-1-AP (same clone as 27873-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 27873-1-AP (CD83 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27873-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 27873-1-AP (same clone as 27873-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 27873-1-AP (CD83 antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27873-1-PBS in a different storage buffer formulation.

CD83 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 27873-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

B cell activation protein, B-cell activation protein, BL11, CD83 antigen, CD83 molecule

---

Product Information

27873-1-PBS targets CD83 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27467

  Product name: Recombinant human CD83 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 22-144 aa of BC030830

  Sequence: EVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRAE

• Full Name: CD83 molecule
• Calculated Molecular Weight: 205 aa, 23 kDa
• Observed Molecular Weight: 37-50kDa, 23kDa
• GenBank Accession Number: BC030830
• Gene Symbol: CD83
• Gene ID (NCBI): 9308
• ENSEMBL Gene ID: ENSG00000112149
• RRID: AB_3742262
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q01151
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CD83 is a member of the immunoglobulin (Ig) superfamily, consisting of an extracellular V-type Ig-like domain, a transmembrane domain, and a cytoplasmic tail. CD83 is one of the most prominent markers for fully matured dendritic cells (DCs) (PMID: 17334966). It is also found on the surface of other activated hematopoietic cells, including lymphocytes, monocytes, macrophages, and neutrophils (PMID: 31231400; 17334966). CD83 regulates the maturation, activation, and homeostasis of numerous immune cells (PMID: 31231400; 32362900). CD83 can also expressed as a soluble form. Soluble CD83 can bind to DCs and inhibit their maturation (PMID: 17334966; 12403928). PNGase F (peptide N-glycosidase F) digestion reduced the 37 and 50 kDa CD83 forms to 28 kDa (PMID: 15320871).