FcZero-rAb® PE Anti-Mouse CD83 Rabbit Recombinant Antibody

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• FcZero-rAb® PE Anti-Mouse CD83 Rabbit Recombinant Antibody (PE-FcA98119)

• Zero Fc receptor binding
• Site-specific conjugation
• One universal isotype

CD83 FcZero-rAb^® Recombinant Antibody for FC

Cat No. PE-FcA98119 Copied!

Clone No. 241002B7

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC

Synonyms

CD83 antigen, mCD83

• 

  FC experiment of mouse splenocytes using PE-FcA98119

  1x10^6 untreated or LPS-treated mouse splenocytes were surface stained with 0.1 ug PE Anti-Mouse CD83 Rabbit RecAb (PE-FcA98119, Clone: 241002B7). Cells were not fixed.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of mouse splenocytes using PE-FcA98119

  1x10^6 LPS-treated mouse splenocytes were surface stained with 0.1 ug PE Anti-Mouse CD83 Rabbit RecAb (PE-FcA98119, Clone: 241002B7) (red) or 0.1 ug PE Rabbit IgG Isotype Control RecAb (PE-FcA98136, Clone: 240953C9) (blue). 1x10^6 untreated mouse splenocytes were surface stained with 0.1 ug PE Anti-Mouse CD83 Rabbit RecAb (PE-FcA98119, Clone:241002B7) (black, dashed). Cells were not fixed.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CD83 in ?

Chat with Able

---

Tested Applications

• Positive FC detected in: LPS-treated mouse splenocytes

Recommended dilution

• Flow Cytometry (FC): FC : 0.1 ug per 10^6 cells in a 100 µl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

PE-FcA98119 targets CD83 in FC applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1387

  Product name: Recombinant Mouse CD83 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 22-133 aa of NM_009856.3

  Sequence: MREVTVACSETADLPCTAPWDPQLSYAVSWAKVSESGTESVELPESKQNSSFEAPRRRAYSLTIQNTTICSSGTYRCALQELGGQRNLSGTVVLKVTGCPKEATESTFRKYR

• Full Name: CD83 antigen
• Calculated Molecular Weight: 21 kDa
• GenBank Accession Number: NM_009856.3
• Gene Symbol: Cd83
• Gene ID (NCBI): 12522
• RRID: AB_3749768
• Conjugate: PE Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 496 nm, 565 nm / 578 nm
• Excitation Laser: Blue Laser (488 nm), Green Laser (532 nm), Yellow-Green Laser (561 nm)
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O88324
• Storage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
• Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

CD83 is a member of the immunoglobulin (Ig) superfamily, consisting of an extracellular V-type Ig-like domain, a transmembrane domain, and a cytoplasmic tail. CD83 is one of the most prominent markers for fully matured dendritic cells (DCs) (PMID: 17334966). It is also found on the surface of other activated hematopoietic cells, including lymphocytes, monocytes, macrophages, and neutrophils (PMID: 31231400; 17334966). CD83 regulates the maturation, activation, and homeostasis of numerous immune cells (PMID: 31231400; 32362900). CD83 can also expressed as a soluble form. Soluble CD83 can bind to DCs and inhibit their maturation (PMID: 17334966; 12403928).