Anti-Mouse CD84 Rabbit Recombinant Antibody, PBS Only

• 

  FC experiment of mouse splenocytes using 98076-1-RR (same clone as 98076-1-PBS)

  1x10^6 mouse splenocytes were surface stained with 0.25 ug Anti-Mouse CD84 Rabbit RecAb (98076-1-RR, Clone: 240903B8) or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were then stained with CoraLite® Plus 647 Anti-Mouse CD4. Cells were not fixed. This data was developed using the same antibody clone with 98076-1-PBS in a different storage buffer formulation.

• 

  FC experiment of mouse splenocytes using 98076-1-RR (same clone as 98076-1-PBS)

  1x10^6 mouse splenocytes were surface stained with 0.25 ug Anti-Mouse CD84 Rabbit RecAb (98076-1-RR, Clone: 240903B8) (red) or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were not fixed. This data was developed using the same antibody clone with 98076-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 98076-1-RR

  Biolayer interferometry (BLl) kinetic assays of 98076-1-RR against Mouse CD84/SLAMF5 were performed. The affinity constant is 0.297 nM.

CD84 Uni-rAb^® Recombinant Antibody for FC

Cat No. 98076-1-PBS

Clone No.240903B8

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC

Synonyms

CD84/SLAMF5, 240903B8, CD84 antigen, SLAMF5

---

Product Information

98076-1-PBS targets CD84 in FC applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1313

  Product name: Recombinant Mouse CD84/SLAMF5 protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 22-221 aa of

  Sequence: KDADPMVMNGILGESVTFLLNIQEPKKIDNIAWTSQSSVAFIKPGVNKAEVTITQGTYKGRIEIIDQKYDLVIRDLRMEDAGTYKADINEENEETITKIYYLHIYRRLKTPKITQSLISSLNNTCNITLTCSVEKEEKDVTYSWSPFGEKSNVLQIVHSPMDQKLTYTCTAQNPVSNSSDSVTVQQPCTDTPSFHPRHAV

• Full Name: CD84 antigen
• Calculated Molecular Weight: 37 kDa
• Gene Symbol: Cd84
• Gene ID (NCBI): 12523
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q18PI6-1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CD84, also known as SLAMF5, is a member of the CD2 subfamily of the immunoglobulin receptor superfamily (PMID: 9310491). CD84 is a single-chain type-I glycoprotein composed of two extracellular Ig-like domains, a hydrophobic transmembrane region, and a cytoplasmic domain. It is broadly expressed on almost all leukocyte subsets. CD84 functions as a homophilic adhesion molecule, whose signaling can activate or inhibit leukocyte function depending on the cell type and its stage of activation or differentiation (PMID: 30522694).