Anti-Human CD85j / LILRB1 Rabbit Recombinant Antibody

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• Anti-Human CD85j / LILRB1 Rabbit Recombinant Antibody (98471-1-RR)

CD85j / LILRB1 Uni-rAb^® Recombinant Antibody for IHC, FC

Cat No. 98471-1-RR Copied!

Clone No. 250502H2

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, FC

Synonyms

LILRB1, CD85, CD85 antigen-like family member J, CD85j, FLJ37515

• 

  IHC staining of human tonsillitis using 98471-1-RR

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 98471-1-RR (CD85j / LILRB1 antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of human PBMCs using 98471-1-RR

  1x10^6 human PBMCs were surface stained with 0.25 ug Anti-Human CD85j / LILRB1 Rabbit RecAb (98471-1-RR, Clone: 250502H2) or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were incubated with FC Receptor Block prior to staining. Cells were not fixed.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of human PBMCs using 98471-1-RR

  1x10^6 human PBMCs were surface stained with 0.25 ug Anti-Human CD85j / LILRB1 Rabbit RecAb (98471-1-RR, Clone: 250502H2) (red) or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were incubated with FC Receptor Block prior to staining. Cells were not fixed.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CD85j / LILRB1 in ?

Chat with Able

---

Tested Applications

• Positive IHC detected in: human tonsillitis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive FC detected in: human PBMCs

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

98471-1-RR targets CD85j / LILRB1 in IHC, FC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3701

  Product name: Recombinant Human LILRB1/CD85j protein (rFc Tag)(HPLC verified)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 24-458 aa of BC015731

  Sequence: GHLPKPTLWAEPGSVITQGSPVTLRCQGGQETQEYRLYREKKTAPWITRIPQELVKKGQFPIPSITWEHAGRYRCYYGSDTAGRSESSDPLELVVTGAYIKPTLSAQPSPVVNSGGNVTLQCDSQVAFDGFILCKEGEDEHPQCLNSQPHARGSSRAIFSVGPVSPSRRWWYRCYAYDSNSPYEWSLPSDLLELLVLGVSKKPSLSVQPGPIVAPEETLTLQCGSDAGYNRFVLYKDGERDFLQLAGAQPQAGLSQANFTLGPVSRSYGGQYRCYGAHNLSSEWSAPSDPLDILIAGQFYDRVSLSVQPGPTVASGENVTLLCQSQGWMQTFLLTKEGAADDPWRLRSTYQSQKYQAEFPMGPVTSAHAGTYRCYGSQSSKPYLLTHPSDPLELVVSGPSGGPSSPTTGPTSTSGPEDQPLTPTGSDPQSGLGRH

• Full Name: leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 1
• Calculated Molecular Weight: 71 kDa
• GenBank Accession Number: BC015731
• Gene Symbol: LILRB1
• Gene ID (NCBI): 10859
• RRID: AB_3746102
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8NHL6
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Background Information

LILRB1, also named as CD85j or ILT2, includes four C2 Ig domains binding HLA class I molecules in the extracellular region and a cytoplasmic domain containing four immunoreceptor tyrosine-based inhibition motifs (ITIM). LILRB1 is a surface glycoprotein detected on the surface of B cells, monocytes, dendritic cells, T cells and NK cells.