CD86 Monoclonal antibody, PBS Only (Detector)

• 

  WB analysis using 68674-2-Ig (same clone as 68674-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68674-2-Ig (CD86 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68674-2-PBS in a different storage buffer formulation.

• 

  WB analysis using 68674-2-Ig (same clone as 68674-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68674-2-Ig (CD86 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68674-2-PBS in a different storage buffer formulation.

• 

  Sandwich ELISA standard curve of MP50056-1

  Sandwich ELISA standard curve of MP50056-1, CD86 Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 68674-1-PBS. Detection antibody: 68674-2-PBS. Standard: Eg0059. Range: 78.1-5000 pg/mL.

• 

  Sample test of MP50056-1

  Serum of sixteen individual healthy human donors was measured. The human CD86 concentration of detected samples was determined to be 1,506.0 pg/mL with a range of 516.7 - 4,914.5 pg/mL.

CD86 Monoclonal Antibody for WB, Sandwich ELISA, Indirect ELISA, Sample test

Cat No. 68674-2-PBS

Clone No.1D6H7

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, Sandwich ELISA, Indirect ELISA, Sample test

Synonyms

1D6H7, Activation B7 2 antigen, Activation B7-2 antigen, B7 2, B70

---

Product Information

68674-2-PBS targets CD86 as part of a matched antibody pair:

MP50056-1: 68674-1-PBS capture and 68674-2-PBS detection (validated in Sandwich ELISA)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Eg0059

  Product name: Recombinant Human B7-2/CD86 protein (Myc Tag, His Tag)

  Source: mammalian cells-derived, pHZ-KIsec

  Tag: Myc & 6*His

  Domain: 26-247 aa of NM_175862

  Sequence: LKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGVMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQPPPDHIP

• Full Name: CD86 molecule
• Calculated Molecular Weight: 329 aa, 38 kDa
• GenBank Accession Number: NM_175862
• Gene Symbol: CD86
• Gene ID (NCBI): 942
• ENSEMBL Gene ID: ENSG00000114013
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P42081
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.