• Zero Fc receptor binding
  • Site-specific conjugation
  • One universal isotype

FcZero-rAb™ APC Anti-Human CD86 Rabbit Recombinant Antibody

CD86 FcZero-rAbTM Recombinant Antibody for FC
Cat No. APC-FcA98043
Clone No.240429C6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC

240429C6, Activation B7 2 antigen, Activation B7-2 antigen, B7 2, B70

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  APC
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC detected inhuman PBMCs

Recommended dilution

ApplicationDilution
Flow Cytometry (FC)FC : 5 ul per 10^6 cells in a 100 µl suspension
This reagent has been pre-titrated and tested for flow cytometric analysis. The suggested use of this reagent is 5 ul per 10^6 cells in a 100 µl suspension or 5 ul per 100 µl of whole blood.
Sample-dependent, Check data in validation data gallery.

Product Information

APC-FcA98043 targets CD86 in FC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg0966

Product name: Recombinant Human CD86 protein (His Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: C-6*HIS

Domain: 26-247 aa of NM_175862

Sequence: LKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGVMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQPPPDHIP

Predict reactive species
Full Name CD86 molecule
Calculated Molecular Weight 329 aa, 38 kDa
GenBank Accession NumberNM_175862
Gene Symbol CD86
Gene ID (NCBI) 942
ENSEMBL Gene IDENSG00000114013
Conjugate APC Fluorescent Dye
Excitation/Emission Maxima Wavelengths650 nm / 660 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP42081
Storage Buffer PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
Storage ConditionsStore at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

CD86 (also known as B7-2) is a costimulatory molecule belonging to the immunoglobulin superfamily. Primarily expressed on antigen-presenting cells (APCs), including B cells, dendritic cells, and macrophages, CD86 is the ligand for two proteins at the cell surface of T cells, CD28 antigen and CTLA-4. Binding of CD86 with CD28 antigen is a costimulatory signal for activation of the T-cell. Binding of CD86 with CTLA-4 negatively regulates T-cell activation and diminishes the immune response. (PMID: 7513726; 1847722; 11029388; 27591335)

Protocols

Product Specific Protocols
FC protocol for APC CD86 antibody APC-FcA98043Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...