CoraLite® Plus 647-conjugated CD86 Recombinant monoclonal antibody

• 

  IF Staining of Raji using CL647-83523-4

  Immunofluorescent analysis of (4% PFA) fixed Raji cells using CoraLite® Plus 647 CD86 antibody (CL647-83523-4, Clone: 240429G12 ) at dilution of 1:200.

CD86 Uni-rAb^® Recombinant Antibody for IF/ICC

Cat No. CL647-83523-4

Clone No.240429G12

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

Synonyms

240429G12, Activation B7 2 antigen, Activation B7-2 antigen, B7 2, B70

---

Tested Applications

• Positive IF/ICC detected in: Raji cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL647-83523-4 targets CD86 in IF/ICC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg0966

  Product name: Recombinant Human CD86 protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 26-247 aa of NM_175862

  Sequence: LKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGVMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQPPPDHIP

• Full Name: CD86 molecule
• Calculated Molecular Weight: 329 aa, 38 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: NM_175862
• Gene Symbol: CD86
• Gene ID (NCBI): 942
• ENSEMBL Gene ID: ENSG00000114013
• Conjugate: CoraLite® Plus 647 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 654 nm / 674 nm
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P42081
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

CD86 (also known as B7.2) is a costimulatory molecule belonging to the immunoglobulin superfamily. Primarily expressed on antigen-presenting cells (APCs), including B cells, dendritic cells, and macrophages, CD86 is the ligand for two proteins at the cell surface of T cells, CD28 antigen and cytotoxic T-lymphocyte-associated protein 4. Binding of CD86 with CD28 antigen is a costimulatory signal for activation of the T-cell. Binding of CD86 with cytotoxic T-lymphocyte-associated protein 4 negatively regulates T-cell activation and diminishes the immune response.