• Zero Fc receptor binding
  • Site-specific conjugation
  • One universal isotype

FcZero-rAb® PE-Cyanine7 Anti-Mouse CD86 Rabbit Recombinant Antibody

CD86 FcZero-rAb® Recombinant Antibody for FC

Cat No. PY7-FcA98025
Clone No.230476B8

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC

230476B8, B7, B7 2, B7.2, B70

Formulation:  PBS, Azide, BSA
PBS, Azide, BSA
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC detected inLPS treated mouse splenocytes

Recommended dilution

ApplicationDilution
Flow Cytometry (FC)FC : 0.1 ug per 10^6 cells in a 100 µl suspension
This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

PY7-FcA98025 targets CD86 in FC applications and shows reactivity with mouse samples.

Tested Reactivity mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg0802

Product name: Recombinant Mouse CD86 protein (His Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: C-6*HIS

Domain: 24-245 aa of NM_019388

Sequence: VSVETQAYFNGTAYLPCPFTKAQNISLSELVVFWQDQQKLVLYEHYLGTEKLDSVNAKYLGRTSFDRNNWTLRLHNVQIKDMGSYDCFIQKKPPTGSIILQQTLTELSVIANFSEPEIKLAQNVTGNSGINLTCTSKQGHPKPKKMYFLITNSTNEYGDNMQISQDNVTELFSISNSLSLSFPDGVWHMTVVCVLETESMKISSKPLNFTQEFPSPQTYWKE

Predict reactive species
Full Name CD86 antigen
Calculated Molecular Weight35 kDa
GenBank Accession NumberNM_019388
Gene Symbol Cd86
Gene ID (NCBI) 12524
Conjugate PE-Cyanine7 Fluorescent Dye
Excitation/Emission Maxima Wavelengths496 nm, 565 nm / 778 nm
Excitation LaserBlue Laser (488 nm), Green Laser (532 nm), Yellow-Green Laser (561 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP42082-1
Storage Buffer PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
Storage ConditionsStore at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

CD86 (also known as B7-2) is a costimulatory molecule belonging to the immunoglobulin superfamily. Primarily expressed on antigen-presenting cells (APCs), including B cells, dendritic cells, and macrophages, CD86 is the ligand for two proteins at the cell surface of T cells, CD28 antigen and CTLA-4. Binding of CD86 with CD28 antigen is a costimulatory signal for activation of the T-cell. Binding of CD86 with CTLA-4 negatively regulates T-cell activation and diminishes the immune response. (PMID: 7513726; 1847722; 11029388; 27591335)

Protocols

Product Specific Protocols
FC protocol for PE-Cyanine7 CD86 antibody PY7-FcA98025Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...