Mouse CD8a Recombinant monoclonal antibody, PBS Only

CD8a Uni-rAb® Recombinant Antibody for WB, IHC, IF-P, Indirect ELISA
Cat No. 85977-4-PBS
Clone No.242879E1

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, IHC, IF-P, Indirect ELISA

CD8, CD8 antigen, alpha chain, CD8α, Ly 2, Ly 35

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85977-4-PBS targets CD8a in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with mouse samples.

Tested Reactivity mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg3265

Product name: Recombinant Mouse CD8A protein (rFc Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-rFc

Tag: C-rFc

Domain: 28-196 aa of NM_001081110.2

Sequence: KPQAPELRIFPKKMDAELGQKVDLVCEVLGSVSQGCSWLFQNSSSKLPQPTFVVYMASSHNKITWDEKLNSSKLFSAMRDTNNKYVLTLNKFSKENEGYYFCSVISNSVMYFSSVVPVLQKVNSTTTKPVLRTPSPVHPTGTSQPQRPEDCRPRGSVKGTGLDFACDIY

Predict reactive species
Full Name CD8 antigen, alpha chain
Calculated Molecular Weight27 kDa
Observed Molecular Weight30-35 kDa
GenBank Accession NumberNM_001081110.2
Gene Symbol Cd8a
Gene ID (NCBI) 12525
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP01731
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

CD8 is a transmembrane glycoprotein that is predominantly expressed on the surface of cytotoxic T cells, and can also be found on natural killer cells, cortical thymocytes, and dendritic cells. CD8 is composed of two disulfide-linked chains and can be present as a homodimer of CD8α or as a heterodimer of CD8α and CD8β (PMID: 3264320; 8253791). The majority of class I-restricted T cells express mostly the CD8αβ heterodimer while CD8αα homodimers alone have been found on some gut intraepithelial T cells , on some T cell receptor (TCR) γδ T cells and on NK cells (PMID: 2111591; 1831127; 8420975). CD8 acts as a co-receptor that binds to MHC class-I and participates in cytotoxic T cell activation (PMID: 8499079). During T cell development, CD8 is required for positive selection of CD4-/CD8+ T cells (PMID: 1968084).

Loading...
||
New chat

Able

正在加载,请稍候...