Tested Applications
| Positive WB detected in | mouse spleen tissue, mouse thymus tissue |
| Positive IHC detected in | mouse thymus tissue, mouse spleen tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse spleen tissue, mouse thymus tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)-P | IF-P : 1:250-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
85977-4-RR targets CD8a in WB, IHC, IF-P, ELISA applications and shows reactivity with mouse samples.
| Tested Reactivity | mouse |
| Cited Reactivity | mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Eg3265 Product name: Recombinant Mouse CD8A protein (rFc Tag) Source: mammalian cells-derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 28-196 aa of NM_001081110.2 Sequence: KPQAPELRIFPKKMDAELGQKVDLVCEVLGSVSQGCSWLFQNSSSKLPQPTFVVYMASSHNKITWDEKLNSSKLFSAMRDTNNKYVLTLNKFSKENEGYYFCSVISNSVMYFSSVVPVLQKVNSTTTKPVLRTPSPVHPTGTSQPQRPEDCRPRGSVKGTGLDFACDIY Predict reactive species |
| Full Name | CD8 antigen, alpha chain |
| Calculated Molecular Weight | 27 kDa |
| Observed Molecular Weight | 30-35 kDa |
| GenBank Accession Number | NM_001081110.2 |
| Gene Symbol | Cd8a |
| Gene ID (NCBI) | 12525 |
| RRID | AB_3738542 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P01731 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CD8 is a transmembrane glycoprotein that is predominantly expressed on the surface of cytotoxic T cells, and can also be found on natural killer cells, cortical thymocytes, and dendritic cells. CD8 is composed of two disulfide-linked chains and can be present as a homodimer of CD8α or as a heterodimer of CD8α and CD8β (PMID: 3264320; 8253791). The majority of class I-restricted T cells express mostly the CD8αβ heterodimer while CD8αα homodimers alone have been found on some gut intraepithelial T cells , on some T cell receptor (TCR) γδ T cells and on NK cells (PMID: 2111591; 1831127; 8420975). CD8 acts as a co-receptor that binds to MHC class-I and participates in cytotoxic T cell activation (PMID: 8499079). During T cell development, CD8 is required for positive selection of CD4-/CD8+ T cells (PMID: 1968084).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CD8a antibody 85977-4-RR | Download protocol |
| IHC protocol for CD8a antibody 85977-4-RR | Download protocol |
| WB protocol for CD8a antibody 85977-4-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The CD8a Recombinant monoclonal antibody (242879E1), catalog number 85977-4-RR, has 11 citations. These appear in journals including Nature Communications, Science Immunology, Cell Death & Disease, Phytomedicine, Materials Today Bio, Journal of Colloid and Interface Science, International Journal of Pharmaceutics X, Frontiers in Immunology, Biochemical Pharmacology, Biomolecules, and Clinical Rheumatology. Research fields span cancer immunosuppression, immunotherapy, nanomedicine, motor neuron disease, and systemic lupus erythematosus.
| Species | Application | Title |
|---|---|---|
Nat Commun YBX1 Confers immunosuppressive bone metastatic traits in non-small cell lung cancer. | ||
Sci Immunol DDX6 induces immunosuppression in cancer by disrupting structural stability of endogenous double-stranded RNAs. | ||
Cell Death Dis Endoplasmic reticulum stress-induced histone lactylation mediating immune escape of gastric cancer via PDIA6 overexpression in dendritic cells. | ||
Phytomedicine Quercetin targets BCAT1 to potentiate CD8(+) T cell immunity by rewiring branched-chain amino acid metabolism against colorectal cancer metastasis. | ||
Mater Today Bio A pH/MMP-9 smart dual-responsive liposome GBE@LP co-delivers and controls the release of GB1107/BMS1166/Enzalutamide for liver cancer immunotherapy. | ||
J Colloid Interface Sci Hollow MnO(2) nanosystem for glioblastoma sono-immunotherapy based on blood-brain barrier crossing and oxygen supply strategy. |
