CD8a Recombinant monoclonal antibody, PBS Only

CD8a Uni-rAb® Recombinant Antibody for WB, Indirect ELISA
Cat No. 86063-1-PBS
Clone No.243018F5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

CD8, CD8a molecule, Leu2, MAL, p32

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

86063-1-PBS targets CD8a in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg0819

Product name: Recombinant Human CD8a protein (His Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: C-6*HIS

Domain: 22-182 aa of NM_001145873.1

Sequence: SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD

Predict reactive species
Full Name CD8a molecule
Calculated Molecular Weight26 kDa
Observed Molecular Weight25 kDa
GenBank Accession NumberNM_001145873.1
Gene Symbol CD8A
Gene ID (NCBI) 925
ENSEMBL Gene IDENSG00000153563
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP01732-1
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

CD8 is a transmembrane glycoprotein that is predominantly expressed on the surface of cytotoxic T cells, and can also be found on natural killer cells, cortical thymocytes, and dendritic cells. CD8 serves as a co-receptor for the T cell receptor (TCR). Both CD8 and TCR recognize antigens displayed by an antigen presenting cell (APC) in the context of class I MHC molecules. CD8 plays a role in T cell development and activation of mature T cells. This antibody is raised against 22-182 aa of human CD8a, the alpha chain of CD8 molecule.

Loading...
||
New chat Able
正在加载,请稍候...