CoraLite®594-conjugated CD8a Recombinant monoclonal antibody

• 

  IF Staining of mouse spleen using CL594-85977-4

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse spleen tissue using CoraLite®594 CD8a antibody (CL594-85977-4, Clone: 242879E1 ) at dilution of 1:200. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse spleen using CL594-85977-4

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse spleen tissue using CoraLite®594 CD8a antibody (CL594-85977-4, Clone: 242879E1 ) at dilution of 1:200. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

CD8a Uni-rAb^® Recombinant Antibody for IF-P

Cat No. CL594-85977-4

Clone No.242879E1

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

IF-P

Synonyms

CD8, CD8 antigen, alpha chain, CD8α, Ly 2, Ly 35

---

Tested Applications

• Positive IF-P detected in: mouse spleen tissue

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL594-85977-4 targets CD8a in IF-P applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3265

  Product name: Recombinant Mouse CD8A protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 28-196 aa of NM_001081110.2

  Sequence: KPQAPELRIFPKKMDAELGQKVDLVCEVLGSVSQGCSWLFQNSSSKLPQPTFVVYMASSHNKITWDEKLNSSKLFSAMRDTNNKYVLTLNKFSKENEGYYFCSVISNSVMYFSSVVPVLQKVNSTTTKPVLRTPSPVHPTGTSQPQRPEDCRPRGSVKGTGLDFACDIY

• Full Name: CD8 antigen, alpha chain
• Calculated Molecular Weight: 27 kDa
• Observed Molecular Weight: 30-35 kDa
• GenBank Accession Number: NM_001081110.2
• Gene Symbol: Cd8a
• Gene ID (NCBI): 12525
• Conjugate: CoraLite®594 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 588 nm / 604 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P01731
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

CD8 is a transmembrane glycoprotein that is predominantly expressed on the surface of cytotoxic T cells, and can also be found on natural killer cells, cortical thymocytes, and dendritic cells. CD8 is composed of two disulfide-linked chains and can be present as a homodimer of CD8α or as a heterodimer of CD8α and CD8β (PMID: 3264320; 8253791). The majority of class I-restricted T cells express mostly the CD8αβ heterodimer while CD8αα homodimers alone have been found on some gut intraepithelial T cells , on some T cell receptor (TCR) γδ T cells and on NK cells (PMID: 2111591; 1831127; 8420975). CD8 acts as a co-receptor that binds to MHC class-I and participates in cytotoxic T cell activation (PMID: 8499079). During T cell development, CD8 is required for positive selection of CD4-/CD8+ T cells (PMID: 1968084).