CoraLux Violet 510 Anti-Mouse CD8a Rabbit Recombinant Antibody

CD8a Uni-rAb® Recombinant Antibody for FC
Cat No. CLV510-98472-2
Clone No.242879C10

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC

CD8, CD8 antigen, alpha chain, CD8α, Ly 2, Ly 35

Formulation:  PBS, Azide
PBS, Azide
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC detected inmouse splenocytes

Recommended dilution

ApplicationDilution
Flow Cytometry (FC)FC : 0.25 ug per 10^6 cells in a 100 µl suspension
This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CLV510-98472-2 targets CD8a in FC applications and shows reactivity with mouse samples.

Tested Reactivity mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg3265

Product name: Recombinant Mouse CD8A protein (rFc Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-rFc

Tag: C-rFc

Domain: 28-196 aa of NM_001081110.2

Sequence: KPQAPELRIFPKKMDAELGQKVDLVCEVLGSVSQGCSWLFQNSSSKLPQPTFVVYMASSHNKITWDEKLNSSKLFSAMRDTNNKYVLTLNKFSKENEGYYFCSVISNSVMYFSSVVPVLQKVNSTTTKPVLRTPSPVHPTGTSQPQRPEDCRPRGSVKGTGLDFACDIY

Predict reactive species
Full Name CD8 antigen, alpha chain
Calculated Molecular Weight27 kDa
GenBank Accession NumberNM_001081110.2
Gene Symbol Cd8a
Gene ID (NCBI) 12525
Conjugate CoraLux Violet 510 Fluorescent Dye
Excitation/Emission Maxima Wavelengths410 nm / 501 nm
Excitation LaserViolet Laser (405 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP01731
Storage Buffer PBS with 0.09% sodium azide, pH 7.3.
Storage ConditionsStore at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

CD8 is a transmembrane glycoprotein composed of two disulfide-linked chains. It can be present as a homodimer of CD8α or as a heterodimer of CD8α and CD8β (PMID: 3264320; 8253791). CD8 is found on most thymocytes. The majority of class I-restricted T cells express mostly the CD8αβ heterodimer while CD8αα homodimers alone have been found on some gut intraepithelial T cells, on some T cell receptor (TCR) γδ T cells and on NK cells (PMID: 2111591; 1831127; 8420975). CD8 acts as a co-receptor that binds to MHC class-I and participates in cytotoxic T cell activation (PMID: 8499079). During T cell development, CD8 is required for positive selection of CD4-/CD8+ T cells (PMID: 1968084).

Protocols

Product Specific Protocols
FC protocol for CoraLux Violet 510 CD8a antibody CLV510-98472-2Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...