Use Able AI chat for product recommendations

Anti-Human CD8a Rabbit scFv Antibody

CD8a Recombinant Antibody for FC

Cat No. SF98470-2-RR
Clone No.243018F10

Host / Type

Rabbit / scFv

Reactivity

human, cynomolgus monkey

Applications

FC

CD8, CD8a molecule, Leu2, MAL, p32

Formulation:  HEPES, EDTA, CHAPS, Sucrose, Proclin300
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC detected inhuman PBMCs

Recommended dilution

ApplicationDilution
Flow Cytometry (FC)FC : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

SF98470-2-RR targets CD8a in FC applications and shows reactivity with human, cynomolgus monkey samples.

Tested Reactivity human, cynomolgus monkey
Host / Type Rabbit / scFv
Class Recombinant
Type Single-chain variable fragment antibody (scFv)
Immunogen

CatNo: Eg0819

Product name: Recombinant Human CD8a protein (His Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: C-6*HIS

Domain: 22-182 aa of NM_001145873.1

Sequence: SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD

Predict reactive species
Full Name CD8a molecule
Calculated Molecular Weight26 kDa
GenBank Accession NumberNM_001145873.1
Gene Symbol CD8A
Gene ID (NCBI) 925
ENSEMBL Gene IDENSG00000153563
RRIDAB_3750163
Conjugate Unconjugated
SourceAnti-Human CD8a scFv from clone 243018F10, consisting of VH-GGGGS linker-VL (N- to C-terminus), with a His-C tag at the C-terminus.
FormLiquid
Purification MethodAffinity purification
Storage Buffer 50mM HEPES, 150mM NaCl, 5mM EDTA, 0.1% CHAPS, 10% Sucrose and 0.1% Proclin300, pH 7.3.
Storage ConditionsStore at 2-8°C. Stable for one year after shipment. 20ul sizes contain 0.1% BSA.

Background Information

CD8 is a transmembrane glycoprotein composed of two disulfide-linked chains. It can be present as a homodimer of CD8α or as a heterodimer of CD8α and CD8β (PMID: 3264320; 8253791). CD8 is found on most thymocytes. The majority of class I-restricted T cells express mostly the CD8αβ heterodimer while CD8αα homodimers alone have been found on some gut intraepithelial T cells, on some T cell receptor (TCR) γδ T cells and on NK cells (PMID: 2111591; 1831127; 8420975). CD8 acts as a co-receptor that binds to MHC class-I and participates in cytotoxic T-cell activation (PMID: 8499079). During T cell development, CD8 is required for positive selection of CD4-/CD8+ T cells (PMID: 1968084).

Protocols

Product Specific Protocols
FC protocol for CD8a antibody SF98470-2-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...